KEGG   Nasonia vitripennis (jewel wasp): 100123561
Entry
100123561         CDS       T01081                                 

Definition
(RefSeq) 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
  KO
K13523  lysophosphatidic acid acyltransferase / lysophosphatidylinositol acyltransferase [EC:2.3.1.51 2.3.1.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00561  Glycerolipid metabolism
nvi00564  Glycerophospholipid metabolism
nvi01100  Metabolic pathways
Module
nvi_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100123561
   00564 Glycerophospholipid metabolism
    100123561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nvi01004]
    100123561
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     100123561
    2.3.1.-  
     100123561
Lipid biosynthesis proteins [BR:nvi01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100123561
SSDB
Motif
Pfam: Acyltransf_C Acyltransferase Frag1
Other DBs
NCBI-GeneID: 100123561
NCBI-ProteinID: XP_008214894
NASONIABASE: NV12833
UniProt: K7IUS3
Position
4
AA seq 387 aa
MGFLATLKRSRIVHLMFAITFFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYS
QLVFMAEWWSGTDVIIYIDKKDFEKYYGKEHGYLVMNHSYEIDWLMGWMFCERIRMLGNC
KAYAKKSIQYIPTLGWAWKFAESIFLERSWDKDKETIGAQIRELADYPDTMWLLLYAEGT
RFTPEKAEASQKFAKEKGLPVLKHHLTPRTRGFTASIPHLRGKVGAIYDIQLAFKPSDTV
KPTMTNLLLGKKVEAHMYINRIPLDTVPEGDEAAAQWLHDIYQVKDRMADSFVKTGDFFE
TSGVPRTDSFKLERRIWSLVNTMFWAIVVLVPMLYYLVRLFLSGSTMYFSIGVGIIVLFF
LLMYKTIGMSEISKSSSYGAAETKKAK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggggttcttggcaacgttaaaacgttcccgtatagtgcatctcatgtttgcaattact
ttcttcacatcaggcttaattataaacttcttccaatgtattctgtattttggattaagg
cctttttcaaaatatttgtaccgtaagattaattactacctctgctactcattttacagt
caattagtatttatggcagaatggtggtcaggcacagatgtcattatttatatagacaag
aaggattttgaaaaatattacggaaaggaacatggttacctagtaatgaatcacagttat
gaaattgattggctaatgggatggatgttctgtgagcgtattcgtatgcttggaaactgt
aaagcttacgctaagaaatccattcaatacattcccactcttggatgggcatggaaattc
gctgaaagcattttcttagagcgaagttgggacaaagacaaagaaacaatcggcgcacaa
ataagagaattggctgattacccagataccatgtggcttctactgtacgcggaaggtaca
cgattcacgcctgagaaggcagaggctagtcagaagtttgcaaaagaaaagggattgccc
gtattgaagcaccatttgacacctcgcacaagagggtttacagcaagtattccacatttg
agaggcaaagttggagctatttatgatattcaattagcattcaagccatccgacactgtt
aagcctaccatgacaaatctcctgcttggaaaaaaagttgaagcgcacatgtacataaat
agaatacctctcgatacagtaccggaaggtgacgaagctgcagcacaatggttacacgat
atttaccaagtcaaagatcgaatggcggatagttttgtaaaaactggagacttttttgaa
acaagtggcgtgcctagaacagattcattcaaattagaaaggagaatttggtctcttgtt
aacactatgttttgggcgattgttgttcttgtacctatgctatattaccttgttaggctc
ttcttgtctggctcaacgatgtacttttctataggagtcggaatcatagttttatttttc
ttattgatgtataaaactatcggaatgtccgagatcagcaagagttcgtcatacggagcg
gccgagacgaaaaaagcaaagtaa

DBGET integrated database retrieval system