KEGG   Nasonia vitripennis (jewel wasp): 100123601
Entry
100123601         CDS       T01081                                 
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 15 isoform X1
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04013  MAPK signaling pathway - fly
nvi04141  Protein processing in endoplasmic reticulum
nvi04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100123601
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100123601
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100123601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100123601
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100123601
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: STE group
  STE11 family
   100123601
SSDB
Motif
Pfam: MAP3K_TRAF_bd Pkinase HisK-N-like PK_Tyr_Ser-Thr ASK_PH TPR-S DRHyd-ASK SAM_2 Pkinase_fungal Kinase-like YrbL-PhoP_reg V-ATPase_H_C
Other DBs
NCBI-GeneID: 100123601
NCBI-ProteinID: XP_016842430
NASONIABASE: NV13729
UniProt: A0A7M7QJ90
Position
5
AA seq 1360 aa
MIFFTSCLQNSIKMPSTCGDTTETTGQAVEGVSGTDSVGTHSDLSGNTTILTRPKMDIVC
LLDTQQPEHLNQRKKALEHVKQACNLVNARLHHIQFEKLDFGETNVLDTFYNADVAVVDL
SIQLQQSSLFYHLGVRESFGMKDNILLVNDVDSEATIRLKLSCGSYTFLPYKFVDCDTSL
SISTSPKIGGEEMIDLTQRLKKLYEEVEIHSKAHIKEKFLTDLRKARETLTGEELARAIT
NMQKRLDDPNVLCGEVVLSLLISFRDIQDYDAMVQLVDDLRTVPNHKSAINTPFIRYHYA
FALNRRHKEGDRERALKVIEEALKKKENHVPDMLGLCGRIYKDMFVESGHTDLESLKNAI
NWYRKGFEVQPNEFAGINLATLLVVAGNEFSKSEELQHIAMVLNNLIGKKGSLSSLKDYW
DVATFFEISVLAEDYSKAIKAAECMFKLKPPDWYLKSTIGNITLIDKFRKKSDETEISPE
EQIFSFWMEYFIEATKSEVGDSIRFPILVLEPTKIYMPSYVIVNLGADEKSIQISNLCLE
SIKHNCKQVHDWLFTANMLRSVSLYKRDERCLFLYVHENSDDFQIYLPSVHCRQRLYDLV
LEMTRDQEGMVTDLDAYMADDSSKIKFEYDLDDQNKRVILGRGTYGVVYAARDLSTQVKI
AVKEIRERNLGDVQPLHEEIRLHSQLRHRNIVQYLGSVSEDGFFKIFMEQVPGGSLSALL
KSKWGPLKRNESTIALYTKQMLEGLKYLHDQKIVHRDIKGDNVLVNTYSGIVKISDFGMS
KRLAGLCPSTETFAGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGS
PQAAVFKVGFYKKHPEIPPELSEKAKNFILRCFEVNADTRATAAELLEDPFIIEKKKTLR
LVAPPDFSRSISVPAERADKMMISDKTNNNIVSQSPMHASQSDDSVVHNGELPKSRRLRE
RSPAHLLSPISMPAASLSYNSCSTIGTTPSIEASEPEVAGNSMTRRSSSGGLLSPDVELT
AGQLAQKSGDEEGGFYLLKKDSQRRMTLTRVLSQDEAKICSLWMQSIQSDVGQKTVLQMN
HLETLTRALKDYISTQNQEAITIAIGKLKEELDFDSTAINQIQLAIYLFQTAVNEVLRMH
SIKPHWMFALDNLVRTAVQAAITVLSPELGANLLGQERAQSTTEGVEEGSTSGVSTVNSI
KSHKTSDSAEHNKFWHEYRDQMGSIKVENMKLLHELLESQKAYQSLLCQALDEQKAQLGA
LTELCESIDKKIRRRNLGIPQISITDRDDEPTADEQLIKWLQSLNIDGNTIERFVSEQYT
LEDILVYVTRDDLRRLNLKGGIELRIWKAILAHRRDAPTN
NT seq 4083 nt   +upstreamnt  +downstreamnt
atgatattttttacaagttgtttacaaaactcaatcaaaatgccttccacttgcggagat
actactgaaactactggtcaagcggtagaaggtgtatctggaactgacagcgttgggaca
cacagtgatctttccggaaacactacaatattaaccagacctaagatggacatagtatgc
ctcttggatacgcaacaaccggaacatttgaatcaaagaaaaaaagcattagaacatgtt
aaacaagcatgcaatttagttaatgccagattacatcacatacagtttgaaaagttggac
tttggagaaacaaatgtactggatacattttataatgcagatgtagccgtagtcgatctg
agcatacagttgcagcaatcatccctgttttaccacttaggagtgcgagaaagttttggg
atgaaagacaatattctcttagttaatgatgtcgattcagaagcaactatccgattaaag
ttatcttgtggtagttatacctttttgccttacaagtttgtggattgcgatactagtctg
tctatatctacttcccctaaaattggaggtgaagaaatgattgatctcacgcaaaggctg
aaaaaactttatgaagaggttgaaatacactcaaaagcacacataaaagagaaattttta
acagatctacgtaaagcaagagaaacccttacgggtgaagagcttgcaagagccatcact
aatatgcaaaagagattggatgatccaaatgttttatgtggggaagttgttttgagtctt
ctaatttcttttcgagatatacaggactatgatgcaatggttcaacttgttgatgatttg
agaacagtaccaaaccataaaagtgcaataaatacaccgtttattcgatatcattatgca
tttgccttaaatcgtagacataaagaaggcgatcgagaaagagcgttaaaagtaattgaa
gaagcattgaagaaaaaagaaaatcatgttcctgatatgttaggtttgtgtggtagaatt
tataaagacatgtttgttgaaagtgggcatactgatctagagagtctgaaaaatgcaata
aattggtacagaaaaggttttgaggttcagcccaatgagtttgctggtatcaacttggct
actctgctagtcgtggctggtaatgaattctcaaagagcgaagagcttcagcatattgct
atggtactcaataatttgataggaaaaaaaggcagtctatcgagtttgaaagattactgg
gatgtagctacatttttcgagattagtgttcttgcggaagattactcaaaagctataaaa
gctgcagaatgcatgtttaaattaaaacctccagattggtaccttaagtccacaatagga
aacatcactctcatagacaaatttcgtaaaaaaagtgatgaaaccgaaatttctccagaa
gagcagattttcagtttctggatggaatattttattgaagccacaaagtcagaagttgga
gatagtattcgatttccaattttagtgttggaaccaacaaaaatttatatgccaagctat
gtgatagtgaatcttggagctgacgaaaagtccatccaaatttctaacttgtgccttgaa
agtataaaacacaattgcaaacaggtccacgattggttatttactgccaatatgttgcga
agcgttagcctgtataaaagggatgaacggtgcctttttttgtacgttcacgagaattct
gatgattttcaaatatatttaccctctgtacactgtagacaaagattgtacgatctcgtt
ttggaaatgacgagagatcaggaaggaatggttacggatttggacgcttatatggctgat
gattcatcgaaaatcaagttcgagtatgacttggacgaccagaataaacgcgttattctc
ggtagaggaacgtatggcgtcgtttacgccgcacgcgatttgagcacgcaagttaaaatc
gccgttaaagaaattcgagaaagaaacctaggcgacgtgcagccattgcacgaggagatt
aggttacacagtcaacttcggcatagaaacattgttcagtacctgggttccgtgagcgaa
gatggattcttcaaaatttttatggagcaggttcctggaggaagtttatcggcgctgctg
aaatcgaaatggggccctctaaaacggaacgaatcgacaattgctctctacacgaagcaa
atgctagagggattgaaatacttgcatgatcagaaaatcgttcatagagatatcaaaggt
gacaacgttttggtgaacacctacagcggaatagtcaaaatctccgatttcggtatgtcg
aagagattggctggtctatgtccaagcacggaaacgtttgctggaacattgcaatacatg
gctccggaggttatcgataaaggtcaacgcggttatggagcaccggctgatatttggtct
cttggctgcaccatagtcgaaatggcaaccggcaagcctccgttcatcgagttggggtct
cctcaagcggccgttttcaaggttggcttctacaaaaaacatccagaaataccacccgag
ttatcagaaaaagctaaaaatttcatactgcgctgcttcgaagtcaatgccgacaccaga
gcaaccgccgccgaattgttggaagatccctttatcatagagaaaaagaagacactccgc
ttggttgcccctccagacttcagtcgtagtatatcagtgcccgccgagagggcggacaaa
atgatgattagcgacaaaaccaacaacaacatcgtctcacaatcccccatgcacgcgtcg
caatcggacgacagcgtcgtacataatggagaactgccgaaatcacgtcgattgagggaa
cgcagtccagcgcatcttctttccccaatcagcatgccggctgcaagtctttcgtacaac
agctgcagcacgatcggcacgacaccctcgatcgaggcgagcgagcccgaggttgctggg
aactccatgacgaggaggagctcatcgggcggtctgctgtcgccggacgtagaactaaca
gcaggtcagctggctcagaaaagtggcgatgaagagggaggcttttacttgctgaagaag
gatagccagcgtcgaatgactctcacgcgggttctaagtcaagacgaagcgaaaatttgc
tctctctggatgcagagcatccaatcagacgttggtcagaagactgtattacaaatgaac
cacctggaaacgctgacgagggcactgaaggattacatatccactcagaaccaagaagcg
atcacgatagccattggtaaattgaaggaagagctggactttgactcgactgccatcaat
cagatacagttggcaatttacttattccaaacagccgtaaacgaggttcttagaatgcac
agcataaagcctcactggatgtttgccctggacaatctcgtgcgaactgccgtacaagcg
gcaatcacagtgctatcaccagaattgggagctaatttactcggacaagagagagcccag
tcgactaccgagggcgtagaagagggttcaacttctggagtctccacggtcaattccata
aaatcacataaaacgagcgattccgctgagcacaataagttctggcacgagtatcgagat
cagatgggctccatcaaggtggagaacatgaaactactgcacgaattgttggagagccag
aaggcttaccagagtttactgtgtcaagcactggacgagcaaaaagcgcaattgggagct
ctgaccgagttgtgtgaaagtatcgataaaaagatacgaagaaggaatcttgggataccg
caaataagtattacggatcgcgatgatgaaccaacggctgacgaacaattaataaagtgg
ctacaaagcttgaatatagatggcaataccatcgaaaggtttgtctctgagcagtatact
ctggaagacatcttggtttacgttacgcgagatgatctacgtagattaaatttgaagggt
ggaatcgaactgaggatatggaaagccatactcgcgcatcggcgagatgcgccaacaaat
tga

DBGET integrated database retrieval system