KEGG   Nasonia vitripennis (jewel wasp): 100123648
Entry
100123648         CDS       T01081                                 
Name
(RefSeq) putative lipoyltransferase 2, mitochondrial
  KO
K23735  lipoyl(octanoyl) transferase 2 [EC:2.3.1.181]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00785  Lipoic acid metabolism
nvi01100  Metabolic pathways
nvi01240  Biosynthesis of cofactors
Module
nvi_M00882  Lipoic acid biosynthesis, eukaryotes, octanoyl-ACP => dihydrolipoyl-H
nvi_M00883  Lipoic acid biosynthesis, animals and bacteria, octanoyl-ACP => dihydrolipoyl-H => dihydrolipoyl-E2
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    100123648
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     100123648
SSDB
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-GeneID: 100123648
NCBI-ProteinID: NP_001229368
NASONIABASE: NV14089
UniProt: A0A7M6UE96
Position
1:complement(2918412..2921318)
AA seq 250 aa
MTSRLVKVFWAGRLSYGAGLQLQKSLVQRHRDRHLYDTPNSVVLLEHNPVYTVGIRNKGY
DEEDESRLRALNADFYRTNRGGLVTFHGPGQLVAYPVIDLKEFRTNVRCYVSQIEKTIIR
LCAEFGLKGETSPDTGVWIEDRKICAIGIHASRYVTSHGFALNCNTDLRWFDHIVPCGIE
EKGVTSLSKELSANVRIEDAIPVFRRAFADEFECEVIDMKSEEISEALKECRNPASVATE
STSAAASSTC
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacctcaagattagtcaaagttttttgggcaggccgcctgagttacggggctggcctc
cagctacagaaatctctcgttcaacgccaccgggaccgacacttgtacgacactccgaat
agcgtggtacttttggaacacaatccggtctacacggttggcattcgaaacaaaggttat
gacgaggaagacgaatctcgtctgcgtgctctcaacgcggatttctaccgtacgaatcgc
ggaggccttgttacttttcacggacctggtcaactagtagcgtatccagtaatcgattta
aaagagtttcgtacgaacgtacgttgttacgtatcgcaaatcgaaaaaacgattattcga
ctttgtgcagaatttggattaaaaggggaaacgtcacctgataccggagtgtggatagaa
gacagaaaaatttgtgctattggaattcatgccagtcggtatgtcacaagtcacggattt
gcgctaaattgtaacacagacctgaggtggtttgatcacatagtgccttgcggaattgaa
gaaaagggagtgacaagtttgagcaaagagttgtctgccaatgtcaggatagaagacgcc
ataccagtgttcaggagagcctttgcagacgagtttgaatgtgaagtaatagatatgaag
agtgaagaaatctcagaggctctgaaagagtgcagaaaccctgcaagtgtagctacagag
agcacttctgctgcagcttctagtacttgctga

DBGET integrated database retrieval system