KEGG   Nasonia vitripennis (jewel wasp): 100123698
Entry
100123698         CDS       T01081                                 

Definition
(RefSeq) serine/threonine-protein kinase unc-51 isoform X3
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04136  Autophagy - other
nvi04140  Autophagy - animal
nvi04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100123698
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100123698
   04136 Autophagy - other
    100123698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100123698
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100123698
   03029 Mitochondrial biogenesis [BR:nvi03029]
    100123698
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100123698
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   100123698
Membrane trafficking [BR:nvi04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    100123698
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100123698
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo APH RIO1 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100123698
NCBI-ProteinID: XP_001607390
NASONIABASE: NV11803
UniProt: K7IRV4
Position
2
AA seq 765 aa
MEVVGDYEYNTKDLIGHGAFAVVFKGRHRKRTNFVVAIKSITKKSLAKSQNLLGKEIKIL
KELTELHHENVVALLDCKESNHNVFLVMEYCNGGDLADYLGAKGTLSEDTIRVFLKQLAG
AMKALHAKGVVHRDLKPQNILLSHSCGKMCPQPHQITLKIADFGFARFLQDGVMAATLCG
SPMYMAPEVIMSLQYDAKADLWSLGTIVFQCLTGKAPFQAHTPQALKMFYEKNANLGPKI
PPGTSPELSNLLMGLLRRNARDRMPFDEFFSHPFLQGPRQSPSPLPVELPASPGTLPAPE
STACDTRSGQETNSPCSSPEDDFVLVPSDLSSDTDNNPNPLQIKYTKQSSREAAASPPRP
CYLPISEPIPVPTTHQRSVAHSGGGVGSGFPVSANRSSAGNSVVPRSQPISMKRSTDSHR
NHAAADIGSLSPPSVQFVIGTPPSRRLSETPPPPNTWQVSPVARHSHTSSGTSPLRRSAG
ANSASSPLLTGPLAVLGSPTTRALHDNNNTLRQSPIIPFGTRAVTLPEISEAGSFHNLFP
ELSSMASDERPLTFIAPELPEETLLEREHNEILAKLNFVVALCECVCEVARTRAGPLGAP
LGAIDQPSNAATRRRAEQVILLVRALQWLSSGLSLATQQLKAGRLQPTASVKEVVNTMNE
KFRACLAECKQLNSAGLLRQTGATADKILYNHAIQMCQSAALDELFGNPAECFQRYHTAQ
ILLHSLSQHVSHSQDRALLIKYKDAVEKRLYVLQQQGYIYATDPT
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagtcgtcggggattacgagtacaacacgaaggacctcattggtcacggcgccttc
gccgtcgtcttcaagggcaggcatcgcaagagaactaattttgtagtggccattaaaagt
attaccaagaagagtctagccaaatctcaaaatttgcttggcaaggaaatcaagatatta
aaggagttaacagaattgcatcatgaaaacgtggtggctctattggactgtaaggagtct
aatcataatgtcttccttgttatggaatactgcaatggtggggatcttgcggattatcta
ggagcaaaaggaacactgtctgaagacactatcagagtatttctaaagcagttggctgga
gcaatgaaagcgttgcatgccaaaggagttgttcacagagatctgaaaccacaaaatatt
ttgctcagtcacagttgtggaaagatgtgccctcaacctcatcagattactctcaaaatt
gctgattttggttttgcgcgatttctacaagatggtgttatggccgcaactctttgcggc
tctcctatgtacatggctcccgaagtcattatgtcgctgcagtacgacgcaaaggctgac
ctttggtctttaggaactatagtttttcaatgtctcactggaaaagctccatttcaggcg
cacacacctcaagctttgaaaatgttctacgaaaagaatgccaatcttggcccaaaaatt
ccaccaggaacttcaccagaattgtcgaacctcttgatgggacttttgaggcgcaacgct
agagataggatgccctttgacgaatttttcagtcaccctttcctgcaaggaccgagacaa
agtccgagtccgcttccggtggagttgcctgcatctcccggaacgctacctgcacctgaa
agtacggcttgcgacactaggtccggtcaagaaaccaacagtccttgctccagtccagag
gatgattttgtacttgtacccagtgatctcagtagtgacacggacaacaatcccaatcca
ctacaaatcaagtacacgaagcagagcagtcgcgaagcagcggcgagtccgccaagaccg
tgctacctgccgatctccgagccgattcccgtaccgacgacacaccagcgcagtgttgct
catagtggtggtggtgtaggctctgggttcccggtgtcggcgaacagatcgtcggcgggt
aatagcgttgtgccacgcagccaaccgatcagcatgaagaggagcaccgactcgcacagg
aatcacgcggcagcggacattggttcgctcagcccaccgagtgtacagttcgtcatcggc
acaccgcccagtcgcaggctaagcgaaactcctcctccacccaacacatggcaagtaagc
ccagtggcaaggcactcccatacgtcaagtggtacgtcgcctttgagacgctcagctgga
gcgaatagtgcttcgtcgccgttgcttaccggacctctggcggtcctgggttcgccgacg
actagagctctgcacgacaacaataacacgctgaggcaatcgcctatcatacccttcggc
actagggccgttactttacctgagatttcggaggctggcagcttccacaatctcttcccg
gagctgagttcgatggctagtgacgagcggccgctgacctttatcgcaccggagctgccc
gaggagacgctgcttgagcgcgagcacaacgagatactggccaagctcaactttgtggtt
gcgctctgtgagtgcgtctgcgaagtcgccaggacgagggctggaccgctgggcgcaccc
ttgggagctatcgaccagccgagcaacgctgctacgaggcgcagggccgaacaggtgata
ctgttggtcagggcattgcagtggctcagttcaggactgagccttgcgacacagcaactg
aaggctggcaggctgcagccaacagccagcgtcaaggaggttgtgaatacaatgaacgag
aagtttagggcttgtttagctgagtgcaagcaattaaatagcgctggactgctccggcaa
actggagcgacagcagataaaatcctttataatcacgctatacaaatgtgccagtcagca
gcgctggatgaactattcggcaaccccgctgagtgtttccagaggtatcacacagcgcag
atcctgctgcactctttatcgcaacacgttagtcatagtcaagacagagctcttcttatc
aaatataaagacgccgttgagaaacgcttgtacgtcctgcagcagcaaggctacatttac
gcaacagatccaacgtag

DBGET integrated database retrieval system