KEGG   Nasonia vitripennis (jewel wasp): 100123791
Entry
100123791         CDS       T01081                                 
Name
(RefSeq) plancitoxin-1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100123791
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     100123791
SSDB
Motif
Pfam: DNase_II
Other DBs
NCBI-GeneID: 100123791
NCBI-ProteinID: XP_003424114
NASONIABASE: NV11825
UniProt: A0A7M7LKD8
Position
2
AA seq 405 aa
MTTMKTNACISTLFCIIVVLSTSVRASSLQCKGEQNQNVDWFVLYKLPRLSNSGNHLIKE
GVAYLYMDSESFAKGWTLSEKDITSNDSIPANTLAPFYNDNIAGDLFWVMYNDQPPNQPA
KLNNGHTKGVVIAGETEGFWLIHSVPNFPPEPNTGNETRRSNSNKIENESEEDTSKDIPR
GIYAYPSSGKVNGQSFLCISTNEANLNTIGKQLMYNQIIVYRRNLPDSLSNKYSVLTDAA
NQVRIKKAPYNSKINLYSTSGMEFTSFAKSSKWQKDLYDDFVAPQLNTDLYTETWMNGRG
KLPSECNKTRVMNIRAISLQKANVEFHSSRDHSKWAVSADEKKKAHWVCIGDINRADTQF
ERGGGTVCLNVPDVWKNYKDSVEDVEPCPKPKSKGFIDRVKSWFS
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgacaacaatgaaaacaaacgcgtgtatttctacattgttttgtattatagtagttcta
agtacatcagtacgagcctcttctctgcaatgcaaaggagaacaaaatcaaaatgtggat
tggttcgttctgtacaaacttccaagactatcgaacagtgggaatcatttgataaaagaa
ggtgtagcttatttgtatatggacagcgagagttttgcgaaaggatggacgctatcggaa
aaggacattacctccaatgattcaatacctgcaaatactctagctcctttttacaatgac
aacattgctggagaccttttttgggtaatgtacaacgatcagccgcccaatcaacccgca
aagttaaacaatggacacacaaaaggtgtagttatagcaggcgaaacagaaggattttgg
ttgatacacagtgtaccgaactttccaccagaaccgaatactggtaatgaaactcggaga
tccaattctaataagattgaaaacgagtctgaagaagatacttctaaagatattcctaga
ggaatttatgcctatccttcgtctgggaaagtcaatggacaaagtttcttgtgcatatca
acaaatgaagctaatctcaacacgattggcaaacaattgatgtacaatcaaattattgtt
taccgaagaaatcttccagatagtctgtcgaataagtattcagtcttgactgatgcagca
aaccaagttcggatcaaaaaagctccttacaacagtaaaatcaatctatactctacaagt
ggcatggaattcacttcgtttgctaagagtagcaaatggcaaaaagatttgtatgatgac
tttgtggcaccacagttgaatactgacttatacactgaaacgtggatgaacggacgtggt
aaattaccatccgaatgtaataaaacaagggtcatgaacattcgagcaatttcattgcag
aaagctaatgttgaatttcacagtagtcgcgaccactcaaaatgggctgtgtctgccgac
gaaaaaaagaaagctcactgggtttgcataggagatatcaaccgagctgatacacaattc
gagagaggtggtggaactgtatgtctaaatgtgcctgatgtttggaaaaattacaaggac
tcagttgaagatgttgaaccttgtccaaagccaaaatctaagggatttattgatagagta
aaatcttggtttagttga

DBGET integrated database retrieval system