KEGG   Nasonia vitripennis (jewel wasp): 100124073
Entry
100124073         CDS       T01081                                 
Name
(RefSeq) serine--tRNA ligase, mitochondrial
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100124073
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nvi01007]
    100124073
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nvi03016]
    100124073
Enzymes [BR:nvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     100124073
Amino acid related enzymes [BR:nvi01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   100124073
Transfer RNA biogenesis [BR:nvi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    100124073
 Prokaryotic type
    100124073
SSDB
Motif
Pfam: tRNA-synt_2b tRNA-synt_2d
Other DBs
NCBI-GeneID: 100124073
NCBI-ProteinID: XP_001607907
NASONIABASE: NV10956
UniProt: A0A7M7G8K1
Position
5
AA seq 429 aa
MRRASRQLLRILNSKRFYSQDALEKKVMPILETEIHLPKPEYNVEFLCNPLNRDLIAKNI
LKRKNSGNIDKVLELHQSLHSQEEFIKELSKIPNLTDPNVLEYADNEPCILRVQGDQPKY
SFEPHEFSQLAAKLRLLRTDRLGPVTGSRSYILLGDLAELEQALITYTLKELLKHNFKLV
SVPDILPSQVIERCGLISDGERKLVYVVEPYYGDDLSLSGTAEMALAYKLSNTVLHENEL
PLKLAAVSRCYRAEVSNLLEERGIYRVHQFTKVEMFICSKQNESVQIMDEVVAIQEKLFG
QLGLHYKVLDMPPNELGSPAYRKIDIEAWMPGRKQFGELSSCSNCTDYQARRLNIKYQDK
NEQIMHSHTLNGTACAVPRMLIAICETHQLEDGNIAVPEQLVPYMNGKTVIKKQNVAETK
QFKGKHKSK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagaagagccagcagacaacttttgagaattttaaattctaagaggttttattcccaa
gatgcactggaaaagaaagtcatgccaattctggaaacagagattcacttaccaaaacct
gaatacaatgtggaatttctttgtaatccattgaaccgagacttgattgccaagaatatt
ttaaaaagaaaaaactctgggaacatagacaaagtgctcgagttgcatcagagtttgcat
tctcaagaggaattcatcaaagagttgagcaaaattcccaatttgacagatcctaatgta
cttgaatatgcagacaatgaaccttgcattcttagggtacaaggagaccaaccaaagtat
agttttgaacctcatgaattctcgcaactggcagccaaattgagattgttgagaactgat
cgcttgggaccagtaactggatctcgaagttacattcttttaggagacttggctgagtta
gagcaagctctcattacttatactttgaaggaactgttaaaacataattttaagttggtt
tctgtgcctgatattttgccctcacaagtaattgagagatgtggattaattagtgatggg
gaaagaaaacttgtttacgtagttgagccatattatggagatgacttgagtctctctgga
actgcagaaatggcactagcttataagttatcaaatacagttttgcatgaaaatgagtta
ccattgaaacttgctgcagtaagtaggtgttacagggcagaagtttctaatttacttgaa
gaaagaggtatttatagagtccatcaatttactaaagttgaaatgttcatttgctccaag
caaaatgaatctgtacagattatggatgaagttgtagcgatccaagaaaagctttttggt
caattaggattacattataaagtattagatatgcctccaaatgaattaggatcaccagct
tatagaaaaattgacattgaagcttggatgccaggtagaaaacagtttggagaactttct
agttgcagcaattgtactgattatcaagctcgtagactgaatattaaatatcaagataag
aatgaacaaattatgcattcacacactttgaatggaactgcatgtgcagtgccccgtatg
cttattgctatttgcgaaacccatcagctagaagatggtaacattgcagtaccagaacaa
ttggtgccttacatgaatggaaaaactgtcataaaaaaacagaatgtagcagaaactaag
cagtttaaaggcaaacacaaatcgaaataa

DBGET integrated database retrieval system