KEGG   Nasonia vitripennis (jewel wasp): 100124215
Entry
100124215         CDS       T01081                                 

Name
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100124215
SSDB
Motif
Pfam: Gpi16
Other DBs
NCBI-GeneID: 100124215
NCBI-ProteinID: XP_008215919
NASONIABASE: NV10496
UniProt: A0A7M7LS48
Position
5
AA seq 569 aa
MVRFHKILLTLAFLSLFSIALAQSDTYDEELMLKPLPNGYVYAYFQFTTLWAAPNTAETF
KHTHLFPRGLAEIIGRHSVEELHITLTEGLWNYEKYGYPFYSAGPGAEISAWFSRNVSDV
DQEWKGLTNALSGLLCASLNFVNPANSLSPEFSFRPTGVVSEIPQSSHLRYSALPRETAC
TENLTPFKKLLPCDSRKGLATLLNSAYIHNTNYHSIGIHFRSVCRDAECMKLSLELKQTV
SLVYDTVTFDTEDWSTRKLFGIGLRGACPLATLSNVYVDLTNNGTTRVFKLAPEPSVTSL
SFRGGQENKYAIYDVRSKTTEAALSIATVHAVQKSSGINYPSILYANRYIIGYGQEKGSL
VTKLYNNHWQPLDIILLENVPWYLPLYLHSMRITRDGEEIQPLAQRYIPGKERKQPYYLE
LVLRLPPRSVTRFSVDIDYMFLKWQEYPPDANHGFYMGPAIITASLPIARNYTALPQDGH
TITSIFNATREGYLVQLRTETLLISLPTPDFSMPYNVICLACTAVALAFGPLHNISTKRL
VLKRIEKQGYLNSFMSKARRLIGLKEKTA
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggttcgttttcacaaaattttgttgactctggcatttcttagtttattttccattgcc
ttggcgcagagtgatacgtatgatgaagagctaatgttaaaacctttacctaatggctac
gtttatgcctattttcaattcacaacattatgggctgctcctaacactgctgaaaccttt
aagcacactcacttatttcctcgaggattagcagagattattggcagacattccgtggaa
gagttacacataacattgacagaaggtctgtggaactatgaaaagtatggatatccattt
tatagcgctgggcctggagcagaaatatctgcatggtttagtagaaacgtgtcagatgtg
gatcaagaatggaaaggattgacaaatgcactttctggattgttgtgtgcttcattaaac
tttgttaatcctgctaacagtttgtctccagagttcagttttaggcctactggtgttgta
tcagaaataccacaatctagtcatttgcgctactcggcattacctcgagagactgcttgt
acagagaatttaacgccatttaaaaagcttttaccctgtgattcaagaaaaggacttgca
acattattaaattcggcatacattcacaacacaaactatcattctatcggtattcatttc
cgttcagtctgtcgcgatgcagaatgcatgaaactatctctggaactcaagcaaacagtt
tctttggtctatgatacagtgacgttcgatactgaggattggtcgactcgtaaattgttc
ggcattggattgcgaggtgcttgtcctcttgccactttgagcaacgtctacgtcgatttg
accaacaacggtaccacccgcgtgttcaagcttgcgccagaaccatcggtaacgtctctg
agtttcagaggtggacaggaaaataaatacgctatatacgatgtgagatcgaaaacgacc
gaggcagcgctaagtatagctacggtccacgctgtacaaaagtcttccggtattaactac
ccgtcaattctatacgcgaatagatacataattggatatggacaggagaaaggatcgttg
gtgacaaagctctacaataatcattggcagccactggacattatactactggaaaacgta
ccctggtatcttccgctctacttacattccatgaggataactcgcgacggagaggagatc
caaccattggctcaacgatacattccggggaaggagagaaagcagccgtactacctggaa
ctcgtgctgcggctaccgcctcgctcagtgaccaggttctccgtcgacattgactacatg
tttctaaagtggcaggagtatccgccggatgcgaatcacggcttttatatgggacccgca
attataaccgcctcgcttcctatcgctaggaactatacggctctacctcaggacggtcac
acgataacttccatattcaacgcgacgcgagagggctacttggtgcagttacgcacggag
acactgctgataagtctgccgacgccggactttagcatgccgtacaacgtgatctgcttg
gcctgtaccgctgtcgctctggcctttggaccgctccacaatatctccacgaagaggctc
gtgctcaagcgcatcgagaagcagggctatctgaattcctttatgtccaaggcgcgacgt
ttaataggcctcaaggaaaagactgcctaa

DBGET integrated database retrieval system