KEGG   Nasonia vitripennis (jewel wasp): 100124286
Entry
100124286         CDS       T01081                                 
Name
(RefSeq) aminopeptidase Ey isoform X1
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00480  Glutathione metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100124286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nvi01002]
    100124286
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100124286
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100124286
   04090 CD molecules [BR:nvi04090]
    100124286
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     100124286
Peptidases and inhibitors [BR:nvi01002]
 Metallo peptidases
  Family M1
   100124286
Membrane trafficking [BR:nvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100124286
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100124286
CD molecules [BR:nvi04090]
 Proteins
  100124286
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 100124286
NCBI-ProteinID: XP_031788192
NASONIABASE: NV10584
Position
5
AA seq 999 aa
MARVKDCKNTTRFGEESMTKSLGAMGMDDRTTTFGRKRGCTVTRCGAFALAMSFFVSVVV
TGLLVYHFAPCIDTSSERRYNRGAGDDESAMFRSGRSFAGSTSKKKLDVRLPTNVRPDSY
ELQLVPFIWEGNFTFNGEVKIVLNVTEDTRKITLHAVDMDIDEEATSLKDYPWIEGRSKN
LRVSRQYNDTARQFHVIQTVETLKAGKQYLLQLKYVGRLNDYLQGFYRSSYTVDNQTRWI
ATTQFQPTDARRAFPCFDEPALKARFQISIARPSNMTAISNMPKERESKPVAGLPTYVWD
HFERSVPMSTYLVAFIVSDFESLHSSQGNVSVWARKEAVQQSDYSLKIGPEILKYFEDYF
QIKFPLPKIDMVALPDFSAGAMENWGLITYRETAMLYQEGVSTSNNKQRVATVVSHELAH
QWFGNLVTPSWWTDLWLNEGFASYVENIGINAVEPSWKALEQFVVHELQNVFGLDALESS
HPISIAVGHPDEINEIFDRISYAKGASIIRMMDHFLSTAVFKRGLTNYLKGKAYQSAEQD
DLWDALTKQAHEDRALGQDVTIKQIMDTWTLQTGFPVVTVIRDYDNDAAVITQERFMLRN
HTKAESQPLWWIPLTYTTSRKLDFNDTKPSIWMKAEKSVLLKNISASSQEWLLFNILETG
YYRVNYDRANWQLIIKQLSGENYDAIATINRAQLIDDALNLARAGRLDYSTALDVTSYLA
HETEYLPWKAALTAMSFLDNMLVKFQGYDKFRVYALKLLDNVYRKVGFKDSLEDPQLTVF
TRIDVLSWACNFGHEDCVRNAVSQFAAWRQSPEPSRNNPISPNLKSVVYCTAIRVGGQPE
WDFMWQRYLETNVGSEKDLLLHALGCTRETWLLSRYLDWALTDNAGIRKQDVTRVFGSVS
SNIIGQPLAFNYFRNKWDRLKEYFGTSLMTINNIVKSSTKRINTKYELKDLLEFANEHKE
ELGSATRAVEQAVEQAEANIRWLERNHATIHDWLKRNTS
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggcgcgagtaaaggactgtaaaaatacgacgcgattcggcgaggagagcatgacgaaa
tcgctgggtgcgatgggcatggacgatcgcacgacgaccttcggtagaaagcgcggctgc
acggtgacgcgctgcggagctttcgctctggcgatgagcttcttcgtgagcgtcgtcgtc
acgggactgctggtctaccacttcgcgccctgcatcgacacctcctcggagcgtcgctac
aaccgtggcgcaggagatgacgaatccgcgatgttcaggtccggcaggagcttcgccggc
tcgacctccaagaagaagctcgacgtcaggctgcccacgaacgtgagacccgacagctac
gagctccagctagtgccgttcatctgggagggcaactttacgttcaacggagaggtgaaa
atcgtgctgaacgtgacggaggacacgcgcaagataacgctgcacgcggtcgacatggac
atcgacgaggaggcgacgagcctcaaggactacccttggatcgagggcagaagcaagaat
ctgagggtgagtcgtcagtacaacgacaccgccaggcagttccacgtcatccagacggtg
gagacgctcaaggccggcaagcagtacctgctgcagctcaagtacgtcggtcggctcaac
gactacctccaggggttctacaggagctcctacaccgtcgacaatcagacgaggtggatc
gcgacgacgcagttccagccgacggacgcccggcgagctttcccctgcttcgacgagccg
gcgctcaaggcccgcttccagatcagcatagcccggcccagcaacatgaccgccatctcg
aacatgccgaaggagcgagagtccaagccagtggccggtctgcccacgtacgtctgggac
cacttcgagcggtcggtgccgatgtcgacctacctcgtcgccttcatcgtctcggacttt
gagtcgctgcactcgagccagggcaacgtcagcgtctgggcgcgcaaggaagccgtccag
cagtccgactacagtctcaagatcgggcccgagatcctcaagtacttcgaggactacttc
cagatcaagttccccctgcccaagatcgacatggtcgccctgccggacttctccgccggc
gccatggagaactggggactcatcacctacagggagacggccatgctgtaccaagagggc
gtctcgacgagcaacaacaagcagcgagtcgcgaccgtggtctcgcacgagctggcccac
cagtggttcggcaacctggtgaccccgagctggtggaccgacctctggctgaacgagggc
ttcgccagctacgtggagaacatcggcatcaacgccgtggagccgagctggaaagccctg
gagcagttcgtcgtgcacgagctgcagaacgtcttcggtctcgacgctctcgagtcctcc
catcccatttccatcgcggtcggacatcctgacgagatcaacgaaatattcgaccgcata
tcctacgccaagggcgcctcgataattcgcatgatggaccacttcctcagcaccgcggtc
ttcaagcgcggactcaccaactacctcaagggaaaagcgtaccagagcgccgagcaagac
gacctgtgggacgcgctgaccaaacaagctcacgaggacagggctctcggccaggacgtg
actatcaagcagatcatggacacgtggacgctgcagaccggattccccgtggtcacggtt
atccgcgactacgacaacgacgcggccgtcatcactcaggagcgcttcatgctgaggaat
cacaccaaggcggaaagccaaccgctctggtggatccccctgacctacacgacatcgcgc
aaactcgacttcaacgacaccaagccgtcgatctggatgaaggccgagaagtccgttctc
ctgaagaacatcagcgccagctcgcaggagtggctgctgttcaacatcctcgagacgggc
tactaccgagtcaactacgaccgggccaactggcaactgataatcaagcagctgagtggc
gagaactacgacgccatagcgacgataaaccgagctcagctgatcgacgacgcgctgaat
ctggccagagccggccgactggattactcgacggccctggacgtgacgtcttacctcgcg
cacgagaccgagtacctgccgtggaaggcggccctcacggccatgagcttcctcgacaat
atgctcgtcaagttccagggctacgacaagttcagggtgtacgccctgaaactgctggac
aacgtgtaccgcaaggtcggcttcaaggacagcctggaggacccccagctgacggtcttc
acgcgcatcgacgtcctcagctgggcctgcaacttcggccacgaggactgcgtgcgcaac
gccgtgagccagttcgccgcctggcgacagagccccgagcccagcaggaacaacccgatc
tcgccgaacctcaagagcgtcgtctactgcacggccatccgcgtgggcggacagcccgag
tgggacttcatgtggcagcgctacctcgagaccaacgtcggctccgagaaggacctgctg
ctccacgcgctcggctgcaccagggagacttggctgctcagcaggtacctcgactgggcg
ctcaccgataacgccggcatcaggaagcaggacgtcaccagggtcttcggctccgtctcc
agcaacatcatcggccagccgctggccttcaactacttcaggaacaagtgggaccgcctg
aaggagtacttcggcacctcgctcatgaccatcaacaacatcgtcaagtcctcgacgaag
cgcatcaacaccaagtacgagctgaaagacctgctcgagttcgcgaacgagcacaaggag
gagctgggcagcgcgacgcgcgcagtcgaacaggcggtggagcaagccgaggcgaacatc
cgctggctcgagcgcaatcacgcgaccattcacgactggctcaagaggaacacctcgtaa

DBGET integrated database retrieval system