KEGG   Nasonia vitripennis (jewel wasp): 100233153Help
Entry
100233153         CDS       T01081                                 

Gene name
Cenp-a
Definition
(RefSeq) centromere protein A
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-T_C Bromo_TP CENP-S
Motif
Other DBs
NCBI-GeneID: 100233153
NCBI-ProteinID: NP_001136354
Position
1
AA seq 131 aa AA seqDB search
MVRRKSSRPKSNASNASSRRNFAMDKHAKKRRVNGMLKEIARLQRSTKLLIPRAPFARLV
RQIMLDLFPRLESQRIQHSALEALQEAAEMYLVQFFEDALLICLHTKRVTLMVQDMILCR
RLRGRGDIINR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtcgaaagtccagccgaccgaaatccaacgcgtcgaatgcttcttcgcgcagg
aatttcgcgatggacaagcacgcgaagaaacgccgagtcaacggaatgctgaaggagatc
gcgcgactccagaggtccacgaagctactcatcccgagagccccattcgctcgactcgtg
cgacagataatgctggacctgtttccgcggctagagtcccagaggatacagcacagcgcg
ctggaggccctgcaggaggccgcggaaatgtaccttgtgcagttcttcgaagacgcgctg
ctcatatgtctgcacacgaagcgggtgacgctgatggtgcaagacatgatactgtgccga
cgactgcgaggccgcggtgatattattaatagataa

DBGET integrated database retrieval system