KEGG   Nasonia vitripennis (jewel wasp): 100678264
Entry
100678264         CDS       T01081                                 

Definition
(RefSeq) zinc finger BED domain-containing protein 1 isoform X2
  KO
K24637  zinc finger BED domain-containing protein 1 (E3 SUMO-protein ligase ZBED1) [EC:2.3.2.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nvi03000]
    100678264
   04121 Ubiquitin system [BR:nvi04121]
    100678264
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100678264
Transcription factors [BR:nvi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BED
    100678264
Ubiquitin system [BR:nvi04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100678264
SSDB
Motif
Pfam: zf-BED Dimer_Tnp_hAT zf-C2H2_12 DUF4413 DUF659
Other DBs
NCBI-GeneID: 100678264
NCBI-ProteinID: XP_003425094
Position
1
AA seq 756 aa
MDTEFLVVHKTEMMESEQGMNSSELETGVDIIEQEQDIEEIDHKRNGLQTVFAKFMEEKH
SITYRKLVVPQSMRSIYWKFFGFPADDDGEILTRVKIVCLLCKTQIAYNRNTSNLRMHLQ
NKHVQELHELEALSPPKKQTITPESKERRAQKRMLKAAMASSSQHIYTTNADGTVQIGGD
IQFVTDPSVAFPEQCMEEDMTVNINKPLKFVIKDGTIDNVSTTSNQNMTFMLSEDQQQQT
SSNNKSVSEAIVEFLIIDLQLPEIVQEQGFQRLIATLKSPCQIPSKNSLEEEIIPTTYNT
FRETILSNISSLTSEVSLAVEEWTSNFGESFFSFLIYYQSPGEAVLESKILCTIHGPRDW
DELQWGTVLDIIMNEWCIKLEKTTAVIASTTRSQLTNALITRGLTVVPCLLHSLQVCAQT
IFENDEVSKVLTNCRSIIGAIASNAEATNAFAVQEQLLGLEENMMIMDYPNVWTSTYTML
QQMIPRREVITMILSSMDGINENVLDLNDEQWQIINDLVEVLEPFKVTIITLSEEKMPLI
SLLKPLLWQLVSAHLKVKEEDSATARAFKESLSDMLCHHYSDPNVSLLLQIATTLDPRFK
EVPYATDEDKKMVATPIKEMLTKLIEENEDSSESQKDCVQVVKKSRISGMELLLGGLRPN
KRGMTTEEKANLELAQYQSEATAPLDNCPLQWWAKVSAKCPNLGSIASRYNCVPVCCPPP
SRIPADVQMAYNAKRAALPPHLVDKMLFLHANHNLV
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggatactgaatttttggtcgttcacaagactgaaatgatggaatcggagcaagggatg
aatagttcggagttggagactggagttgacatcatcgagcaagagcaggacattgaggag
atagatcacaagcggaatggtttgcagactgtatttgccaaatttatggaagagaaacat
tccattacgtacaggaagcttgtggttcctcagtcaatgagaagcatatactggaagttc
ttcggatttcctgcagatgacgatggagaaattctgaccagagttaaaatagtttgcttg
ctgtgcaagactcaaatcgcttacaataggaatactagtaacttaaggatgcacctgcag
aataaacacgttcaagagttgcatgagctggaagcgctcagtccacccaagaaacaaacc
atcactccagagagtaaagagaggagagcacaaaagagaatgttgaaagcagccatggca
tccagttcacagcatatatataccactaatgccgatggcacagtgcaaataggtggagac
attcagtttgtgactgatccaagtgtggcttttcctgaacagtgcatggaggaagacatg
actgtaaacattaacaaaccgttaaagtttgtcattaaggatggtactattgataatgtt
tccaccactagtaatcagaatatgacttttatgctgtctgaagaccagcagcagcagact
tcctcaaataacaagtcagtttcagaagctatagtagaattcttaataatagatttgcaa
ctgcctgaaattgtacaagagcaaggtttccaaagactcatagctactctgaagtcccca
tgtcagatacctagtaaaaattcattggaagaagagatcatacctacaacctacaacaca
ttcagggaaacaatactgtccaacatttcttctttaacaagcgaagtaagcttagcagtg
gaagagtggacgtctaattttggtgaaagcttcttttcctttctcatctactaccaaagt
ccaggtgaagctgtcttggaatcaaagattttgtgtacaattcatggacctagagattgg
gatgagctgcagtggggaactgttttggatattataatgaatgaatggtgcatcaagttg
gagaaaacaactgctgtcattgcatcaaccacaaggtcacagttaacaaatgctttgatt
accagaggtttgactgtggttccttgcttactgcactctcttcaagtttgtgcacagaca
atttttgaaaatgatgaagtgagcaaagtcttgaccaactgtagatcaattattggagcc
attgcaagtaatgctgaagcaactaatgcttttgctgtgcaagaacaacttcttgggttg
gaagaaaatatgatgataatggactatccaaatgtctggacgtcaacatacacaatgctt
cagcaaatgattcctcgtagagaagtgattacaatgattctcagcagtatggacgggatc
aatgaaaatgtattagatttaaatgatgagcagtggcagatcatcaatgatcttgttgaa
gttcttgaaccttttaaagtaaccatcataacgctaagcgaggagaaaatgcctttgatt
tctctgttaaagccattgctttggcagctggtgtcggcgcatctgaaggtaaaagaagaa
gattctgctaccgcgcgagcttttaaggaatcgttgtcggatatgttatgccatcattac
tcagatcctaatgttagtttgttgttgcaaatcgcgacaaccttggaccctagatttaaa
gaggtaccttatgctacagacgaagataaaaaaatggtagcaacgcctataaaagagatg
cttacaaaactcatagaagaaaacgaagattcgagtgaaagtcaaaaagactgtgtgcag
gtcgttaaaaaaagtcgaatatcaggaatggaattgcttcttggtggtcttcgccccaat
aaacgaggaatgaccaccgaagaaaaagcgaatctcgaactcgctcagtatcaatcagaa
gcaactgctccattggacaattgtccacttcagtggtgggcaaaggtctcggcaaagtgt
cccaatctcggtagtatagctagccgttacaattgtgttccggtttgctgcccgccacct
tctaggatacccgccgacgtacaaatggcttacaatgctaaaagagccgcattgccacct
catttggtcgacaagatgttgtttctgcacgcgaatcataatttagtgtga

DBGET integrated database retrieval system