KEGG   Nasonia vitripennis (jewel wasp): 103316308Help
Entry
103316308         CDS       T01081                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103316308
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    103316308
Enzymes [BR:nvi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103316308
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   103316308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 103316308
NCBI-ProteinID: XP_008207535
Position
5
AA seq 1196 aa AA seqDB search
MQESRIPSAVVLIVYPPNPQPFLPNNDGDDRYYDPSSPFSSRDTNDTSIPDELFFSEETP
QPDIDERRFLPPRDLGRNSLDNLLAIVPFDQRYEVQRLLNGTTSYESPRTVDHLREALDV
LTTTEDENNVNGSAEAGLNSFNNKMFTYGLLSYSAEASWQPVLTVTEQLEGLSVREILKS
GFADEEIFDLLCDDQSDCPVEKMSGIPLHTAHIVAIILGSLLFALTAIITAALIRRHLLK
KRMSKGPYKIILTATDFVFPQIPDARRVDEGIEAMLCCWLQQLQEFGGPEVEKPDLLQGS
VGSLRPHLQASNGNLARHIFNDPRARYNGDLVQLKQLPVQGAFELKGKAMDVLVTIHGLR
HENLNPLIGCLTEPSRPCIVYEYCSRGSLEDVLVQDEIKLDWSFRLSLLTDLVRGMKYLH
STPIRVHGYLTSRNCVIDARWVLKVTDYGLPAFYEAQNVQPPERTARDLLWTAPELLRHA
GLQKRGSQPGDVYSFGIVMQEVVVRGEPFCMLALSPEDIIEKVKKPPPLIRPSVSKGAAP
PEAINIMRQCWAENADMRPDFNAVHDLFKKLNHGRKVNFVDTMFQMLEKYSNNLEELIRE
RTEQLDMEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEEFAEVTIYFSDIVGFTTISAYST
PFQVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGCPVRIPDHASQIATMALDLLH
QSGKFKLRHLPNTQLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGAPWRI
HLSQATRDRLTQVGGYVIEYRGRTDIKGKGKMPTYWLLGKQDFDKELPVPPPLGEDHGIE
DILILETLQTSEQQQQQQQPQQQPSDSTSSLIAHLTGQLPTLNSTEDDSSAECSVAVSLP
AVATTSRESHASPAKFAHSEQSSIDKGTGLKRVAVSVHEDRAAVLGQSFSMRSVGPSDTI
DVAFCRDGTRSTPDYASATVTKSTSGDNPMTLGESASCLSERSEGTPVSATEVAAALLGA
SSTSINSVSSSVFRGRPRRVGVIDEDDLSTPYNHYRCLSPNEHSYAGKTSFEPSIAEKSL
HARRTLGRSRIKSLDIESSIAAGRAGGSCRLLRRQFSLDRADEPTGASSSGAASSSEQQV
PLQHRPPPRLFKQNSAGAANDLERIEEVPSTPQASAGQAYRHSASVSLSVESLTLR
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagtcccgaatcccaagtgcagtggttctcatcgtctaccctccgaaccctcag
cctttcctgcccaacaacgatggcgacgatcgttactacgacccgtcgtccccgttctcc
tccagagacaccaacgacacttccatcccggacgagctgttcttctccgaggagacaccg
caacctgacatcgacgaaagacgcttcctgccaccacgagaccttggaaggaacagcctc
gacaacctcctggccatcgttcccttcgatcagaggtatgaggttcagaggctgttgaac
ggcacgacgagctatgaatcaccacgtacagtggaccatctccgtgaggctttggacgta
ctgacgacaactgaagacgagaacaacgtcaacggctcggccgaggctggacttaactcc
ttcaataacaagatgttcacctacggtctgttgtcgtatagcgcagaggcgagttggcag
cctgtgttgacggtcaccgaacagttggaaggactttcggtgagagagatacttaagagc
ggatttgccgacgaagaaatattcgaccttctctgcgatgatcagagcgactgccctgta
gaaaaaatgtctggaattcctctacacactgcacatatcgtagctattatactgggctca
ttactgtttgcgttaacagctataatcaccgccgccttaatacgaagacacctgttgaag
aaacgtatgtccaagggaccttacaaaattatattgacagccacggacttcgtttttcct
caaattccagacgccagacgagtggacgagggcatcgaggcgatgttgtgctgctggttg
caacagctgcaggagttcggcggtccggaagtggagaaaccagacctcctgcaaggcagc
gttggctctctccgtccacatctgcaagcgagtaacggtaatctcgccagacacatattc
aacgatccccgtgcgcgatacaacggcgatctggttcaacttaagcagcttcccgttcaa
ggtgccttcgagctcaaaggcaaggcgatggacgtactggtcacgatacatggtctgcgc
cacgagaatctaaaccctctgatcggctgcctgacagagcccagcaggccatgcatcgtc
tacgagtactgctcgagaggctccttggaggacgtccttgtgcaggacgagatcaagctc
gactggtccttccgactctcgcttctcaccgacctcgtcaggggcatgaagtacctgcac
agtacaccgatacgcgtacacggctacctgacgtcccggaactgcgtcatagatgcccga
tgggtgctcaaggtcacggactatggactgccagctttctacgaggcccagaacgtccag
ccgcccgagagaactgccagagacctgctgtggacagctccggagttgctgaggcacgca
ggcttgcaaaagcggggcagccaacccggtgacgtctacagcttcggcattgtcatgcag
gaagtcgtggtgcgcggagaacccttttgcatgctcgctctctcgcccgaagacatcatc
gagaaagtgaagaagccgccgcctctgataaggccatctgtgagcaaaggcgcagcgcca
ccggaagctatcaatatcatgcgccagtgttgggccgagaacgcggatatgcgaccggac
ttcaacgccgtccacgatctcttcaagaagctcaatcacggcaggaaagtcaatttcgtt
gacacgatgtttcaaatgctggaaaaatactcgaacaatctcgaggagctgattcgcgag
aggaccgaacagttggacatggagaagaagaaaacggaacaattactgaaccgcatgctt
ccgagctcggtagcggaaaaactgaagctcggcatgccagtggacccagaggagttcgcc
gaggtgacgatctatttctcggacatcgttggcttcactaccatatccgcctactcgacg
cccttccaagtggtcgacctgctcaacgatctgtacacatgcttcgacgcgacgatcaac
gcctacaacgtctacaaggtggagacgataggcgacgcttacatggtggtcggcggctgt
cccgtgaggataccggatcacgccagtcagatagcgacaatggctctagacctgctacat
cagagcggcaagttcaagctccggcacttgcccaatactcagctcaggctcagaatcggc
cttcacacaggaccatgttgcgctggagtcgtgggtctgacgatgccaaggtactgtctc
ttcggcgacactgtgaacacggcttcgcggatggagtcgacgggtgcaccctggcgcatc
cacttgagtcaggcgacacgagatcggttgacacaagttggcggctatgtcatcgagtac
cggggacgtactgatatcaagggtaagggcaaaatgcctacctactggctactgggcaag
caggattttgataaggagctgccggtgccaccaccactcggcgaggatcatggaatcgaa
gatatcttaatcctggagactcttcaaacctccgagcaacaacaacagcaacaacaaccc
cagcaacagccctcggattcaacctcaagtctaatagctcatcttaccggtcaacttcca
acgctaaactcaacagaagatgatagttcagccgagtgtagcgtcgcggtctccctccca
gccgtcgctaccactagtcgtgaatcacacgcatcaccagccaagttcgcccacagcgaa
caatcgtccattgacaaaggcacaggtctcaaacgagtagccgtgtcagtacacgaggac
agagcagctgttctgggccaaagtttctccatgagatcggtaggaccgtccgatacgatt
gacgtggctttttgcagggatggaaccaggtcgacgccggattacgctagtgctactgtc
acgaaaagcaccagcggggataaccccatgacgctgggtgagtctgccagttgcttgtcg
gagcggagcgagggtacccctgtatcagcaacagaagtagcagcagcgcttctcggtgcc
tcatcaacgtccatcaactcggtttcgagctcggtgtttcgcggaaggcctcgtcgggtt
ggcgtcatcgacgaagatgacctaagcacaccttacaatcattaccggtgcttgtcgcca
aacgagcactcgtatgccggcaaaacgtcgttcgagccgagcatcgcggagaaaagcctg
cacgcgcgtcgcaccctcggtcggtctcgaatcaagtcgctggacattgagagtagtatc
gctgcaggccgggctggcggtagctgccgactcttacgccggcagttcagcctggaccga
gctgacgagccgacaggagcatcgtcttcgggagcagcttcttcgtccgagcagcaagtg
ccgctgcaacacaggccaccgccgaggctcttcaaacagaacagcgcaggtgcggccaac
gacctggaacgcattgaagaggtgcccagtacgcctcaggctagtgctgggcaagcttac
aggcactcggcttccgtgtcgctgtccgtagagtcgctcacattgcgctga

DBGET integrated database retrieval system