KEGG   Nicrophorus vespilloides: 108556988Help
Entry
108556988         CDS       T04922                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00450  Selenocompound metabolism
nvl00970  Aminoacyl-tRNA biosynthesis
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108556988
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108556988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nvl01007]
    108556988
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nvl03016]
    108556988
Enzymes [BR:nvl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108556988
Amino acid related enzymes [BR:nvl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108556988
Transfer RNA biogenesis [BR:nvl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108556988
 Prokaryotic type
   Other AARSs
    108556988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS DUF1759 GST_N_5 tRNA-synt_1 GST_C_2
Motif
Other DBs
NCBI-GeneID: 108556988
NCBI-ProteinID: XP_017768839
Position
Unknown
AA seq 1068 aa AA seqDB search
MPVIYTNESNPAGLKLIISAKFGSVNYQVKIIESADKTVPAPRVLPYVETDRETVIFSSN
AGAQYFYPNKEVDSTNSVQQWLDFEVYELAQSLALVIGGSSKVQKIKDILSSSLKLLNDK
LKEGAPLNGKTIEVCDIAVWSALYPLHNDKKMSKEYLEPYPDILNWMTHFTENTFVKEAL
AEFKILDALTSYQALLIGAKYTAVNIKSSTEVATANPDVVSPEELKSAEEAFKKTLNNLP
KPKKEVHPILPVAGEKNVLITSALPYVNNVPHLGNIIGCVLSSDVFARFSRLCNWNTLLI
GGTDEYGTATETKALEEGLTPQQICDKYFEIHNNIYRWFNIGFDYFGRTTTPEQTRLVQD
MFITLNNNGFMQTQPVEQLLCEKCNRYLADRFVEGGCPHPGCNYEDARGDQCDGCGKLVN
STELKNPRCKVCRTAPVKRTSKQFFLDLPKLEPLLHHWMEKSSQGWTNNAKVISKSWMKE
GLKPRCITRDLKWGVPVPLDGYRDKVFYVWFDAPLGYVSMTSKYTKDWEKWWRPAKETDI
TLFQFMAKDNVPFHSVMFPATLLGANKGYTLVSHIMATEYLNYEDGKFSKSRGVGVFGTD
AQETGIPSDVWRFYLLYVRPEGQDSSFSWVDLATKNNSELLNNLGNFVNRALVFTEKFFG
STVPAMNLTEEDLTVLALCTRELKSYVASLEKAKLRDGIRYILAISKHGNQYMQSTQPWV
LLKRTDDDKQRAGTVVGVCVNIACLLATLMLPYMPDSSRALKAQLNAPPETNILTPDNPE
IVMFLPEGHKIGKPAPLFSKIEPAQVEEMKKKFGGQQSDKPSAVSGDVSALEKAIQEQGD
KVRVLKSSGSPKTTWQPEVAILLDLKKKLEAAQKAVPASAPTSVSGDVATLEKAVQEQGE
KVRSLKSSGVPKATWQPEVTILLDLKKKLEAAQKAAPASAPSSGSDDVASLEKAVQEQGE
KVRSLKSSGVPKATWQPEVTILLDLKKKLEAAQKSTVTASPSTNGVAIADVNEIQCAIDK
QALLVRQLKEGGAAKSEWSPQVTILLDLKAKLAAATGQPSTGGKKSKK
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgatctacacgaacgaaagtaatccagctggcctgaagctgataatcagtgcg
aaattcggttcagttaattatcaggtgaaaataattgaatcagcagataaaactgttcct
gctccaagagtgttaccatatgttgagacagatcgggaaacagtaatcttctcaagcaat
gctggtgctcaatacttttaccccaataaagaagtggactctacaaacagtgtgcagcaa
tggttagactttgaggtttatgagttggctcagtccttggcccttgtcatcggaggctct
agcaaagtgcaaaaaattaaagatattttaagtagcagtttaaagttactcaatgataaa
ttgaaggaaggtgcacctttgaatgggaaaaccattgaagtttgtgatattgctgtgtgg
agtgctttgtatcctctgcacaatgacaagaaaatgtctaaggagtacttggaaccttac
ccagacattttaaattggatgactcatttcactgagaatacttttgtgaaggaagcgctt
gctgaattcaaaatcctggatgcgttaacttcttatcaagctttgttgattggagctaag
tatactgcggttaacattaagagctccaccgaagttgcgactgctaatcctgatgttgtc
tcacctgaggagctgaaatcggcggaggaggcgtttaagaagaccttaaataacttaccg
aaaccaaagaaggaagttcatccaatattgccggtagccggtgaaaaaaatgtacttatt
acatcagcgttgccttatgtgaataatgtaccgcatttgggcaatatcattggatgcgtt
ttatcttccgacgtgtttgctagattctctcggttatgcaattggaacactttgttgatt
ggtggtactgatgagtacggtacggccacagagactaaagccttggaagaaggattaacg
cctcaacagatttgcgacaagtatttcgagattcacaataatatttataggtggttcaat
attggattcgattatttcggccgcaccacaacacctgaacaaacacgtttagttcaagat
atgttcattaccttgaacaataatggattcatgcaaacgcagcccgttgaacaattgctc
tgcgagaaatgcaaccggtatttagcagacagattcgttgagggcggttgtccacatcca
ggatgtaactacgaagatgcccgcggtgatcagtgcgatgggtgcggtaaactagtcaat
tccacggaactgaagaatcccagatgcaaggtttgccgcacggcgccggtgaagagaacg
tccaagcaattcttcttggatcttccaaagcttgaaccgctcttgcaccactggatggag
aaatcgtcgcaaggctggaccaacaacgctaaggttataagtaaatcttggatgaaggaa
ggtttgaagccgcgttgcattacgcgagatcttaagtggggagttccagttccgttagat
ggttaccgtgataaggtattttacgtgtggttcgatgctcctttggggtatgtatcgatg
acttcgaaatatacaaaagattgggagaagtggtggagacctgccaaggaaactgatatt
actttgttccaattcatggctaaagataacgttccgttccattctgtaatgtttccagct
actttacttggtgctaacaaaggctacactttggtgtctcatattatggccactgagtac
ttaaattatgaagatggcaaattctccaaatccaggggtgtcggtgttttcggcactgat
gctcaagaaactggtattccaagtgacgtttggcgtttctacttactctacgtgagaccg
gaaggacaagattccagcttcagttgggtcgatctggcgactaaaaataattcggaatta
ttaaataacttgggcaacttcgtcaacagagctcttgttttcactgagaagttcttcggg
tccaccgttccagcaatgaatttgaccgaagaagatttaactgtattagctctgtgcact
cgtgaattgaagtcgtatgtggcttctctggagaaggcgaaattaagggacggtattcgt
tacattctggctatctccaagcatggtaatcaatacatgcaatctactcaaccttgggta
ttacttaaacgaaccgacgatgataagcaaagagctggaactgtcgtgggtgtttgcgtt
aatatcgcctgcctcttggctactttgatgttaccttacatgccagacagcagcagagct
cttaaggctcaattgaacgctcctccggaaaccaatattttgacacctgataaccccgaa
attgtcatgttcttaccggaaggtcataaaattggaaaaccagccccattgttcagcaaa
atcgaacccgctcaagttgaagaaatgaagaagaaatttggtggacagcaaagcgacaaa
ccgtctgcagtaagtggagatgtatcagcgctggaaaaggcaattcaagaacagggtgat
aaagtgcgtgtactcaagagcagcggttctccaaaaaccacgtggcaaccagaggtagct
atcttgttggatttgaagaaaaagttggaagctgcgcaaaaggccgttccagcatccgcc
ccaacctctgtctctggagatgtggctacgctagagaaagccgttcaagagcagggtgag
aaagttcgttccttgaagagcagcggtgttccgaaagcgacgtggcaacctgaagttact
atcctgttggatctcaagaaaaaactggaagctgctcaaaaggctgcacctgcgtccgct
ccatcttctggttctgatgatgtagcttctctcgagaaagccgttcaagaacagggtgag
aaagtgcgttctttgaaaagcagcggtgttccaaaagcgacgtggcaaccggaagtaaca
attttattggacctgaagaaaaaactggaggctgctcaaaaatcgactgtaacagcttca
ccaagtaccaatggtgttgctattgctgatgttaacgaaatacaatgtgcaattgataaa
caggccttattggtaaggcagttgaaggaaggcggtgcagcgaaaagcgaatggtctccg
caagtaaccattttacttgacttgaaagctaagttagcagcggctaccggacagccgtcg
actggcggtaaaaagtcgaagaaatga

DBGET integrated database retrieval system