KEGG   Nicrophorus vespilloides: 108557383Help
Entry
108557383         CDS       T04922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04068  FoxO signaling pathway
nvl04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108557383
   04068 FoxO signaling pathway
    108557383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvl01001]
    108557383
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108557383
Protein kinases [BR:nvl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108557383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 108557383
NCBI-ProteinID: XP_017769366
Position
Unknown
AA seq 457 aa AA seqDB search
MAVVGPSRHSRGGSMSVSMSLMQGAAGPTAGAQQGGLHAAQPYYHPQHAAAPAHTQEQVQ
PDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLS
ALDILQPPHLDFFQEIYVITELLQSDLHKIIVSHQPLSSDHIKVFMYQILRGLKYIHSAR
ILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDSSKHMTQEVVTQYYRAPEILMGARHYT
AAVDVWSVGCIFGELLGRRILFQAQNPIQQLELITELLGTPSLTDMRYACEGAKTHMLNR
AQKPSSLTALYTLSNQATPEVVHLLCQMLVFDPDKRMTVVEALAHPYLDEGRLRYHSCMC
KCCYTTNSGMRQYTTEFETTAPQPFDDRWERKLTSVRQVKEEMHKFIAEQLNTSRVPLCI
NPQSAAFKSFASSSVAHPSEXPTVASPMGLTLVTRTT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggtcgggccgagccgccactcgagaggagggtcgatgtctgtctcgatgtcc
cttatgcagggtgcggcgggacccacggccggtgcccaacagggcggcctccacgctgct
caaccttattaccatccccagcatgctgctgctcctgctcacacccaagagcaagtgcag
ccggatagaccgatcggctatggtgcttttggtgttgtttgggctgtaacggatccacgt
gatggacgtcgcgtcgccctcaagaagttgccgaatgtgttccaatccttggtgtcctcc
aaaagagtattcagggaactgaaaatgctgtgcttcttcaagcacgaaaatgtgttatca
gccttggatattctgcaacctccgcacttagacttcttccaagaaatatacgttataaca
gaactcttgcagagcgatcttcacaagatcatcgtttcccatcagccactttcttcggac
cacatcaaagtattcatgtaccaaattctcagaggactgaaatatatacattctgccagg
atattgcatagagacataaaaccaggaaacctccttgtcaatagtaattgtgttcttaag
atttgtgatttcggattagcgcgcgtcgaggaacccgactcctcgaagcacatgacccaa
gaggtcgtgactcagtactacagagccccggagatcctcatgggcgctcgccactacact
gccgccgtggacgtatggtcggtgggctgtattttcggtgagcttctgggtcgaaggatc
ctgttccaggcccagaatcccatccagcagttagagctgatcaccgagctgctgggaacg
ccgtcgctgacggatatgaggtacgcgtgcgaaggtgccaaaacccacatgctcaacagg
gcccagaagccttcatcccttactgccttgtacaccctctcgaatcaggcgacaccggaa
gtcgtccatctcctatgccagatgctcgtcttcgatcccgacaagaggatgaccgtcgtc
gaagcgctcgctcatccttacctggatgagggtcgactcaggtaccattcctgcatgtgc
aaatgttgttacacaacgaacagcggaatgaggcagtacacgaccgagttcgagactacc
gctcctcaacccttcgatgaccgctgggaacggaagctgacgtccgtgcgccaggtgaaa
gaggagatgcacaaattcattgcggagcaattgaacacgagtagagtgccactttgtata
aatccgcagtcagctgcattcaagagtttcgccagttcgtcagtggcacatccgtcggaa
nctccaaccgtcgcctcaccaatgggactgaccctggtcactaggactacgtag

DBGET integrated database retrieval system