KEGG   Nicrophorus vespilloides: 108558369Help
Entry
108558369         CDS       T04922                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1-like isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00430  Taurine and hypotaurine metabolism
nvl00480  Glutathione metabolism
nvl00590  Arachidonic acid metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108558369
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    108558369
   00480 Glutathione metabolism
    108558369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nvl01002]
    108558369
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nvl04090]
    108558369
Enzymes [BR:nvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     108558369
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     108558369
    3.4.19.14  leukotriene-C4 hydrolase
     108558369
Peptidases and inhibitors [BR:nvl01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   108558369
CD molecules [BR:nvl04090]
 Proteins
  108558369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept ODV-E18 DUF4519 Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 108558369
NCBI-ProteinID: XP_017770753
Position
Unknown
AA seq 640 aa AA seqDB search
MVDFRNLVQTNHQPHTTLLKRKRFVEVRNEQTLIVNGTERTRQDNRTFSNIPRLKKSVVL
PVVAVILVIIVIVILYLTGVLGSENETTTTSPANPTMPMRPSVSSLHTFSKAAVCADGPP
CAQIGQQILQQKGSAVDATLAALFCNGLVNMQSMGLGGGFLMTIYKKDARKAYTLNARET
APLAATPNMFQNKPKAARKGPLSIGVPGELKGYWEAHQKFGKLDWKTIIQPTIDLCDKGY
KLTIPQHKTAEKINFTTPTYKKWFYNDDGNLKKVGETVKPEVLCNTLRIIAEKGAEDFYT
GSLSKMILDDLKKANSIITAEDLKNYSPVWADPISVTLNNGDQLYSTPPPGSGILLAFIL
KILDGFNFTRQSIDGVENTVQTYHRMIEAFKYAYAKRTELGDTKFINIDNLINKLASPQY
AEEIRLKIRDNQTFTDPAHYGAVFYDDSGDNGTAHISVLDEYGDAVSVTSTINLYFGSEV
ISESTGITFNSVMDDFSTPGFKNYFGLPGSPNNAIAPGKRPLSSMSPSVMTDKNGDVILV
VGASGGTQITTGIAQVIMRILWFGQNIKEAVDSPRIHHQVYPMQLGYEYGTLQQIIDGLE
KLGHNTTRLTSYSVICGLFKKNDTIFANADHRKGGDVYGY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactttaggaaccttgtgcagacgaaccaccagccccacacgacattgctaaag
cggaaacggttcgtggaggttagaaatgagcaaacgcttattgtcaatggtacggaaagg
acgaggcaagacaatcgaacttttagcaatatacctagactaaaaaaatcagtagtgtta
ccagttgtggccgtgattttagtgataatagtcatagtaatattatatctaacgggagtt
ttgggatcggaaaacgagacgacgacaacttctcctgcgaatccgacgatgccaatgcga
ccttcagtatcttccttgcacaccttttccaaggccgcagtttgtgcagatggaccacct
tgtgcccaaattggacagcaaatattacaacagaaaggatccgctgttgacgcaacgttg
gctgcattattctgtaatggtttggtgaacatgcagagtatgggcttaggaggcggcttt
ctgatgactatctacaagaaggatgcacgcaaggcttacactctaaatgcacgtgaaacg
gcaccattagctgcgaccccaaacatgttccaaaacaaaccgaaagcagcaagaaaagga
ccactttccattggagtacctggagaattgaaaggctattgggaagctcaccaaaagttc
ggaaaactcgactggaaaacgatcatccaaccgacaatagatttgtgcgacaaaggatac
aaactgacaatccctcaacacaaaactgcagaaaaaatcaatttcaccactccgacttac
aagaaatggttttacaatgacgatggtaatctgaagaaggttggagaaacggtgaaaccg
gaagtattgtgcaacacgctgaggataattgcggaaaaaggagcggaggatttctataca
ggatcactatctaaaatgatattggacgatttgaagaaggcaaactctataataacggca
gaggacttgaaaaactacagtccggtttgggcagacccaatttccgttactttgaacaat
ggtgatcagctatactccactcctccacccggttccggtattttgttggcctttatattg
aaaatcctcgatggatttaatttcactcggcaaagtattgatggcgttgaaaatacagtt
caaacatatcatagaatgatcgaagcatttaaatacgcgtatgccaagagaactgaactg
ggagatactaaatttattaatatcgataatttgatcaacaaattggcttcgcctcaatac
gctgaagaaatccgattgaaaattagagacaatcaaacatttacagatcctgctcattac
ggtgctgtcttctacgatgattctggtgataatggtacagctcatatatctgtactggac
gaatacggtgatgctgtttctgttactagtaccatcaatttatattttggatcggaagta
atctccgaaagcacaggtatcaccttcaacagcgtgatggatgatttttcaacacccgga
ttcaagaactattttggtttaccaggatccccaaataatgcaattgcaccaggaaaaagg
cctttgtcatcgatgagtccgagcgtaatgactgacaaaaacggtgatgtgattttggta
gtcggagcatctggaggaacacaaatcacaactggcatagctcaagttattatgagaata
ctatggtttggacaaaatattaaagaagctgtagattcaccaagaatccatcatcaagta
tacccgatgcaacttggttatgaatacggaactcttcagcaaatcattgatggtttggag
aagctcggacataataccactcgccttacatcgtactctgttatatgtggtctgttcaag
aagaacgacaccatctttgccaatgccgatcatcgaaaaggcggcgacgtttacggttat
taa

DBGET integrated database retrieval system