KEGG   Nicrophorus vespilloides: 108558938Help
Entry
108558938         CDS       T04922                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2 isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvl01001]
    108558938
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108558938
Protein kinases [BR:nvl01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   108558938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 108558938
NCBI-ProteinID: XP_017771519
Position
Unknown
AA seq 353 aa AA seqDB search
MSSIVKPSARIPKTTPISVDYEISNNVLGLGINGKVVECFSKKTKEKYALKVLHDCVKAR
REVDLHWRASGCIHIVNIIDVYENTYSNKKCLLVVMECMEGGELFQRIQDKPDGAFTERE
AARVMHEICIAVKFLHDTHIAHRDLKPENLLYSLSGPLGILKLTDFGFAKNTFNNATLQT
PCYTPYYVAPEVLGPDRYDKSCDIWSLGVIMYILLCGFPPFYSNTGMPISPGMKKRIRTG
QYNYPDPEWQNVSQDAKDLISGMLNIDADKRLTIDEVIKNNWIAQYTAVPQTPLHTHKML
KEGEEIWPEVQEEMTRSLASMRVDYDQVHIKALENSNNPLLNKRRKKISVTEN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagctctattgtaaaaccgtcagctcgtatacctaaaacaactccgattagtgtcgat
tatgaaatatctaataatgtcctgggattgggaatcaacggtaaagtggtggaatgcttc
tcgaaaaaaaccaaggaaaaatatgctctgaaggttttgcatgattgtgtcaaggcaaga
agggaggtggatttgcactggagggctagtggctgcatacacattgttaacattattgat
gtatatgaaaatacttatagcaacaagaaatgcttgttagttgtgatggaatgcatggag
ggtggagagttgttccaacgcatacaggacaagccagatggagcatttaccgagagagaa
gctgcacgagtcatgcatgaaatttgtattgctgtgaaatttctacatgacactcacatt
gcccacagagacttaaaaccagagaacttactttattctctttctggtcctctaggaata
cttaagcttacagattttggttttgcaaaaaatacttttaacaatgctactttacagacc
ccatgttacactccatattatgttgctccagaagttttggggccagatagatatgataaa
agctgtgacatttggtcattaggtgttattatgtacatactgttatgtggattccctcct
ttttatagtaacactggcatgccaatttcgccaggaatgaaaaagcgtatacgcacagga
caatacaactacccagatccagagtggcaaaacgttagccaagatgctaaggatttaatt
agtggaatgttaaatattgatgcagataaaaggctgactattgatgaagttattaagaac
aattggattgctcaatatactgcagtgcctcaaacaccgttacacacgcacaagatgttg
aaggaaggtgaagaaatttggcctgaagtgcaggaggaaatgacccgctctttggcttcg
atgagagtcgattacgatcaagttcacatcaaggccctggaaaattcgaacaatccgctg
ttgaacaaacgtcgcaagaagatctccgtaactgaaaattaa

DBGET integrated database retrieval system