KEGG   Nicrophorus vespilloides: 108559131Help
Entry
108559131         CDS       T04922                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04136  Autophagy - other
nvl04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108559131
   04136 Autophagy - other
    108559131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvl04131]
    108559131
   03029 Mitochondrial biogenesis [BR:nvl03029]
    108559131
Membrane trafficking [BR:nvl04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108559131
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108559131
Mitochondrial biogenesis [BR:nvl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108559131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 108559131
NCBI-ProteinID: XP_017771769
Position
Unknown
AA seq 224 aa AA seqDB search
MAIILVIGLPLAACQYSSLVIGVLLDNNNNNNNASMNVFMLYAKNPLHSPHFFNSRCSRK
RNARLQKEIEEACRDTRGVSPDDMRDNAGPYYESSTLPTTPVMKFDAHDGEVNAVKWSPV
DRLLATGGADRKVKLWDVSKGSAENRGILQGSNAGVMSVDFDNTGTLVLGASNDYASRVW
TVCDQRLRVSFICKPVLSVNPFFFVLFRLPIGVDKPSVAGLMVQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggccatcattttggtaataggtttaccgctcgctgcttgccagtactccagtttggtt
attggtgttttgctcgataacaacaacaacaacaataatgcatccatgaatgtgtttatg
ctttatgccaaaaatccacttcattctcctcatttctttaactcccgttgttccaggaaa
cgaaacgccagattgcagaaggaaatcgaagaggcgtgtcgcgacaccagaggcgtctct
ccagatgatatgcgcgacaacgcaggtccatactacgaatcctccaccctaccaacaact
ccagttatgaaatttgatgcccatgatggcgaggtgaatgcggtgaaatggagtcccgtg
gataggctcctcgcgaccggaggcgccgacaggaaagtcaagttatgggatgtttccaaa
ggctcggccgaaaaccgcggcatattgcagggtagtaatgcaggtgttatgtctgttgat
ttcgataatactggtaccttggttcttggggcttccaatgactacgcgagccgtgtgtgg
actgtttgcgatcagcgattaagggtgagttttatatgcaaacctgtgctttctgtaaac
cccttttttttcgtcctctttcgtttaccgattggagttgataagccttccgttgctgga
ctaatggtccaataa

DBGET integrated database retrieval system