KEGG   Nicrophorus vespilloides: 108559481Help
Entry
108559481         CDS       T04922                                 

Definition
(RefSeq) receptor-type guanylate cyclase Gyc76C-like isoform X1
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00230  Purine metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108559481
Enzymes [BR:nvl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108559481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA WD-3
Motif
Other DBs
NCBI-GeneID: 108559481
NCBI-ProteinID: XP_017772271
Position
Unknown
AA seq 1590 aa AA seqDB search
MRLGPALLVALLPLFTWTAAVAAATTTTTAVVFDDLFGGGGWRSVAGRRDVDATYHSSPM
EERELPSDDLRLGTVANENNVEDDDDDDEWKRRRTRTTAAVAKNKKKSLTVGYLTAVKGE
LKERQGLAVSGAITMALDEINKDESMLPNVTLVLRWNDTRGDTVVATRAMTDMICDGVVA
FFGPEGTCHVEAIVAQARNIPMISYKCSDYKASDVPTFARTEPPDTQVTKYVISLMKYYD
WKKFTIIYEEAWKTVALSLVDQAKLRNMTINDFKNAEDRHKCCEETLPCCLSGYWYQFIQ
ETKNRTRIYVFLGTPMSLIELMNTMQTAQLFDKGEYMVISVDVNTYSDKMAHKYLWKPEV
FDKFNTCLDHQKDFEKRGKSLFVIVPTAPTENYENFTASVRHYNELEPFNFTKPDIFLNY
QKFVSIYAAYLYDSVKLYATALHALLLREPHLTEEIIAEIAGNGTRIVETIISLGTYKSI
TGATMRLDKNGDSEGNFSVLALTRHPSNTVIKNFTCAYQMRPVGQFQQGEFPDYQINPNV
KIEWPQDSRPNDEPSCGFNNEMCKKNDTHLNSIIAAGILAILLFCAGVITMSIYRKWKIE
QEIEGLLWKIDRTDIHGYLEDINSPTRASLLSVSVASYESRGGAQVFATTAEYKGLVVRI
KELNFSRKKDISREVMKEMRLLRDLRHDNINSFIGACVEPMSIFLVTDYCAKGSLYDIIE
NEDIKLDRMFVASLVHDLIKGMMYIHNSMLVCHGNLKSSNCVVTSRWVLQVTDFGLAEMR
HCAESDSIGEHQHFRNLFWKAPEMLRHPSQYIRGTQKGDVYAFGVILYEIIGRKGPFGLC
EYEPKDIIEQVKSVPQDGECPFRPDLEVLVDSEIGCDDYVMQSMRDCWAEKPEDRPDFGE
VRTRLKKMKDGKNRNIMDQMMEMMVTYADHLEELVSERTQLLHEEKLKTEDLLHRMLPKP
VAERLTMGYGVEPEWFDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIKGYD
VYKVETIGDAYMVVSGLPIRNGDNHAGEIASMSLDLLSAVKNHSIAHRPKETLKLRIGIH
TGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEPLKIHISPQCKEALDKLGGYVVEERG
LVAMKGKGQVRTYWLTGANESAIQRREVDLGELPPLFCRPRRSPKLNTDSRQASFCGNLC
NFNGLNSRRHSSVPRAIIISDTYCCDREEHCLEGTSTEVESTSTLHNSSPIAGRLRYSRN
VLHVPEMAASRQTLDSTTAFGSQNITEAIGGLRSRRVLSSIASSSDEHQRTSSGGSQMVL
NGGRAMRESRSLDPLPMGGRRQQQQLQLQQAVQTVFDTPTHAMGGDYDDGRRNRRRPQSL
ENCCHLDAGVHLQNIRIMAIPDDRMPGHQQQQQPPTNNNNNNNNNFPNGDVINATSAAIC
EDYGTTGSGSSCSLMEDAEMPLLRSGGGKTAKVVGTVLRRRVGSVEETMEDEDYDDGSVE
VDEHARKQWRSLETVPTVGDNQTMMHDGGATKNSIIPAPLKTLFNFFNGNGLKTSNTSLR
KGGSVGGGGGGRVGGGVGGNALQAEKESIV
NT seq 4773 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggtccggcccttctggtcgcgctgctacctctcttcacgtggaccgccgcc
gtcgccgccgccaccactaccaccaccgctgtcgtcttcgatgatctcttcggaggtgga
ggatggaggagcgttgccggacgtcgcgacgtcgacgccacttaccattcgtcgccgatg
gaagagcgcgaactcccgtcggacgacctgcgactcggcaccgtcgccaacgagaacaac
gttgaagatgacgacgacgacgacgagtggaagaggagaagaacgagaacgacggcggcg
gttgcgaagaataagaagaagagtctcaccgtcggttacttgactgcggtcaagggagaa
ctcaaggagaggcagggtctcgctgtctccggcgccatcaccatggccctggacgagatc
aacaaggacgagtcgatgctgccgaacgtgacgctggtgctcagatggaacgacacgcga
ggtgacaccgtcgtcgcgacgcgtgccatgaccgacatgatctgcgatggcgtcgtcgcc
ttcttcggaccggagggtacttgccacgtcgaggcgatcgtcgctcaggctcgaaacata
ccgatgatcagctacaaatgctccgattacaaagcctccgacgtgcccaccttcgccagg
accgaacctccggacacccaagtgacgaaatatgtgatatcgttgatgaagtactacgat
tggaaaaagttcacgatcatctacgaggaggcttggaagacggtggcgctctcgttggtc
gatcaggcgaaattgaggaacatgactataaacgatttcaagaacgccgaggatcgtcac
aagtgctgcgaggagacgttgccgtgttgcctatccggttattggtatcagttcatacag
gagacgaagaatcgcacgagaatttacgtcttcctcggcactccgatgtccctcatcgaa
ctcatgaacacgatgcagacggctcagctcttcgacaagggcgagtacatggtcatctcc
gtcgacgtgaacacgtactcggacaaaatggcacacaagtatctctggaaaccggaagtc
ttcgacaagttcaacacgtgcttggatcatcagaaggatttcgagaaacgcggcaaatcc
ctgttcgtcatcgtcccgactgcgcccacagagaactacgagaatttcacggcgagcgtt
cgacactacaacgagctggaaccgttcaactttaccaaacccgacatcttcctcaactat
caaaagtttgtgtcgatttacgcggcctacctgtacgattcggtgaaactgtacgcgacc
gctctgcacgcgctccttctccgagaacctcacctgaccgaagagatcatagcggagatc
gccgggaacggcacgcgaatcgtcgagaccatcatcagcctgggcacttacaaaagtata
accggggcgacgatgcgcctggacaagaacggcgattccgaaggtaacttctcggtactc
gccttgactcgtcaccctagcaacaccgtcatcaagaactttacgtgcgcctatcagatg
cgacccgtcggccaattccagcaaggggagtttccagattatcaaataaatccgaacgtg
aagatcgaatggccgcaggactcgcggcccaacgacgaaccgagctgcggcttcaacaac
gagatgtgcaagaagaacgacactcatctgaacagcatcatcgccgccgggattctcgct
atacttttgttctgcgctggcgtgatcacgatgagcatctacaggaagtggaagatcgag
caggaaatcgaaggtctcttgtggaagatcgatcgtaccgatattcacggatatcttgag
gatatcaattcgccgacacgagcgagtttgttgagcgtcagtgttgcttcgtacgagtct
cgcggtggcgctcaagtcttcgcgacgacggccgaatacaagggtctcgtggtgcgaata
aaagagttgaacttttcgcgaaagaaggacatctcgagggaggtgatgaaggagatgcgt
ctgctgcgagatctccggcacgacaacatcaactcgttcatcggggcgtgcgttgagccg
atgtccattttcctagtcacggattactgcgccaaagggagcctatacgatattatagag
aacgaggatattaaattggacaggatgttcgtggcctccctcgtccatgatctcattaag
ggcatgatgtacatacacaattcgatgctggtgtgccacggcaacctgaaatcctcgaac
tgcgtggtgacgagtcgctgggtgctgcaggtgacggatttcgggttggcggagatgcga
cactgcgccgagagcgacagcatcggggagcatcagcatttcaggaatctgttctggaag
gcgcccgaaatgctccggcatccgtcgcagtacatccgcggcactcagaagggggacgtc
tacgcgttcggcgtcatcctctacgagatcatcggacggaagggtccgttcggtctctgc
gagtacgaacccaaagatataattgagcaggtgaaaagcgttccgcaggatggggaatgt
ccgttccgaccggacctggaggtgctcgtcgactcggagatcggttgcgatgactacgtt
atgcaaagcatgcgcgattgttgggccgagaagccggaggacaggccggactttggcgaa
gtccggacgagactgaagaagatgaaggacggaaagaataggaatataatggatcaaatg
atggaaatgatggtgacgtacgccgatcatttggaggagttggtgagcgagaggacgcaa
ctgctgcacgaggagaaactgaagacggaggatctgctgcaccgaatgttacccaaaccg
gttgcggaaagattgacgatgggctacggcgtcgagcccgaatggtttgatctagttacg
atatactttagtgatattgttgggttcactgcgatgtctgcggagagcacacccttacaa
gtagttaattttctaaatgatctctatacagtattcgatcggattatcaaaggatacgac
gtgtacaaggtggaaacaatcggtgacgcgtatatggtcgtgtccggtctgcccatccgc
aacggcgataatcatgccggcgaaattgcctccatgtctttggatctcctctccgccgtc
aagaatcattctatagcgcatcgaccgaaagagacgctcaagttgcgcatcggaatacac
acgggtccagtggtggccggtgtcgtcgggttgaccatgcccagatactgtctgttcggt
gatacggtgaacactgcgtcccgtatggagagcaacggggaaccgctcaagattcacatc
agtcctcagtgcaaggaggcgctggacaagttgggcggatacgtggtggaggagaggggt
ctggtcgcgatgaagggcaaaggacaggtgaggacgtactggttgacgggggcgaacgag
agcgccatccagcggcgcgaagtggatctgggcgagctgccgcctctgttctgccgcccc
cgaaggagtccgaagctgaacacggacagcaggcaggcctccttctgcggaaacttgtgc
aactttaacggtctgaacagcaggaggcattccagcgttcccagagcgataatcatttca
gatacttattgctgtgatagagaggaacattgtctggaaggtacgagtacggaggtggag
agcacatcgacgttgcacaattcgagtcctatagctggtcgcctgaggtacagcagaaat
gttctgcacgtccccgagatggcggcgtccaggcagaccttggattcgacgacggccttc
ggcagtcagaacatcaccgaggcgatcggagggttgagatcgcgacgcgtcctctcgagc
atcgcctccagctcggacgagcaccagaggacgagcagcggcggcagtcagatggtgctg
aacgggggacgagcgatgagggagtccagatctctggatcctttgccgatgggtggacga
cgtcagcagcagcagctgcagctgcagcaggcggtacagacagttttcgacacgcccacg
cacgcgatgggcggagactacgacgacggcaggaggaacagaaggaggcctcaatctctg
gagaactgctgccatctggacgcaggagttcatctgcagaacattaggataatggccatc
cccgatgaccgtatgccaggtcatcagcagcagcagcagccgccgacgaacaacaataac
aacaacaacaacaactttcccaatggcgatgtgattaatgcgacgagtgccgccatctgc
gaggattacggtacgacggggagcggaagcagctgcagtttaatggaagatgcggagatg
ccgctgctgcgcagtggtggcggcaaaacggcgaaagttgtcgggacggtgctgaggcga
cgcgtcggcagcgtcgaggagacgatggaggacgaagattacgacgacggtagcgtggaa
gtggacgagcacgcgaggaagcagtggcggtcgctggagacggtgccgaccgtcggcgat
aaccagacgatgatgcacgacggaggtgcgacgaagaatagcatcatccctgcaccgctg
aagactttgttcaactttttcaacgggaacggcctgaagacgagcaacacctcgttgagg
aagggcggcagcgtcggcggaggcggcggtggaagggtaggaggtggcgtaggcggtaac
gccctccaagctgagaaggaaagcatcgtctag

DBGET integrated database retrieval system