KEGG   Nicrophorus vespilloides: 108560328Help
Entry
108560328         CDS       T04922                                 

Definition
(RefSeq) annexin B9 isoform X1
  KO
K17095  annexin A7/11
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108560328
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108560328
  Exosomal proteins of other body fluids (saliva and urine)
   108560328
  Exosomal proteins of colorectal cancer cells
   108560328
  Exosomal proteins of bladder cancer cells
   108560328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Sigma70_ner Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 108560328
NCBI-ProteinID: XP_017773310
Position
Unknown
AA seq 325 aa AA seqDB search
MSNQQYFPFKCTPTVFPADPFDPVADAATLRKAMKGFGTDEKAIIDVLARRGIVQRLEIA
ETFKTSYGKDLISELKSELGGKFEDVIVALMTPLPQFYAKELHDAVAGLGTDEEAIIEIL
CTLSNYGINTIAQFYEQTYGKSLESDLKGDTSGHFKRLCVSLCQGNRDENQGVNEAQATA
DAEELIAAGEDKWGTDESAFNAILISRSYQQLRQTFAEYERLTDKDIEESIKKEFSGSVE
KGLLGIVKCVKSKVGYFAERLHDAMAGLGTKDKTLIRIVVSRSEIDLADIKQAFLDKYGK
TLESWIQDDVDGSMQHLLITMTAYG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccaacagtatttcccattcaagtgtacaccaactgtattcccggcggatcct
ttcgatcctgtcgccgatgccgccaccctccgcaaagccatgaagggcttcggtaccgat
gaaaaggcaatcatcgacgtcttggctcgccgcggaatcgtgcagcgtcttgagatcgcc
gagaccttcaagacttcctacggcaaggatctgatctctgagttgaagagcgaactcgga
ggcaaattcgaggatgtcatcgtcgctttgatgacccctcttcctcaattctacgccaag
gaattgcacgacgccgttgctggattgggtaccgacgaggaggccatcatcgagatcctc
tgcactctctccaactacggcatcaacaccattgcccaattctacgagcaaacttacgga
aaatctttggaaagcgatttgaaaggagacacttccggtcatttcaagcgtctttgcgtt
tcgctctgccaaggcaacagggatgagaatcaaggtgtcaacgaagcccaagccaccgcc
gatgcggaagaactgatcgccgctggagaagataaatggggtaccgatgaaagcgccttc
aacgccattctgatctcacggtcctaccaacagttgagacagaccttcgccgagtacgag
cgtcttaccgacaaggacatcgaggaatccatcaagaaagagttctcaggatccgtcgag
aagggactcttgggaatcgtgaaatgcgtgaagagcaaagtaggttacttcgctgagaga
ttgcacgacgccatggctgggttgggcaccaaggataaaactttaattaggatcgtcgtt
tcccgttctgaaatcgatttggctgacatcaaacaggcgttcctcgacaagtacggaaaa
actttggagagctggatccaagacgacgtcgatggctctatgcaacacttgttgatcaca
atgactgcctatggctaa

DBGET integrated database retrieval system