KEGG   Nicrophorus vespilloides: 108560662Help
Entry
108560662         CDS       T04922                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00190  Oxidative phosphorylation
nvl01100  Metabolic pathways
Module
nvl_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108560662
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     108560662
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     108560662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 108560662
NCBI-ProteinID: XP_017773795
Position
Unknown
AA seq 261 aa AA seqDB search
MASILRQLTRTIRSPIVQNRVVASSNGLRFKTTAPAEPKEETRPTVRKFDPAQREQLKDF
GQYVAECMPKYVQKVQLTAGDELEVLIAPDGIVPILQFLKDHHNCQFTNLTDIAGMDVPS
RQFRFEIIYNMLSVRFNSRIRVKTYTDELTPIDSCNDVYKAANWYEREIWDMYGVFFANH
PDLRRILTDYGFEGHPFRRDFPLTGYVEVRYDDEKKRVVIEPLELAQEFRKFELAAPWEQ
FPNFRNAPAASEEIPIKDEEK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgattttaaggcaattaacgaggacaattcgttcacctattgtgcagaacaga
gtggttgccagcagcaatgggcttcgattcaaaactactgcaccagcagaacccaaagaa
gagaccagaccgactgtgcgcaagtttgatcctgcccagcgtgagcagctgaaagatttc
ggacagtatgtggctgaatgcatgcctaaatatgtgcagaaagttcagctgactgctgga
gatgagttggaagttcttattgccccggacggtattgtccccattttgcagttcctcaag
gatcaccacaattgtcaattcaccaacctgactgatatcgctggtatggacgtgcctagc
aggcagttcagattcgagatcatctacaatatgctgtcggtgagattcaattctcgcatc
cgcgtgaagacctacaccgacgaattgaccccgatcgattcctgtaacgatgtttacaag
gcggctaattggtacgagagggaaatctgggacatgtacggcgtgttcttcgccaaccat
ccggatttgagaaggatcctgacagattacgggttcgagggacatccgttcaggagggac
ttcccccttaccggttacgtggaggtgcgttacgatgacgagaagaagagggtggtcatc
gaacctctcgagttggcccaagagttcaggaagttcgagctggccgccccttgggagcaa
ttccctaacttcaggaatgccccggccgcctccgaggagattcccatcaaggatgaagag
aagtga

DBGET integrated database retrieval system