KEGG   Nicrophorus vespilloides: 108560880Help
Entry
108560880         CDS       T04922                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nvl01002]
    108560880
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108560880
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108560880
Peptidases [BR:nvl01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108560880
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108560880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_2 Peptidase_S9 Abhydrolase_3 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 108560880
NCBI-ProteinID: XP_017774080
Position
Unknown
AA seq 352 aa AA seqDB search
MPYERNKFHGGHKVIELYKDFKYNIIRDDKVTVNSKCCLGWSKRISLWTLKLALVIFFLI
FIVGPFIYKYCYGVQRSLVFLNFVSWPKNPDFDNPRKYGVDGAINFYLDTDEGVRLGVWH
ILPENLVNNRTEYSREYFGDVLRDGQNVMIYNHGNSGHRVAPHRXXXDGLVKDSEFIYNW
VTNRTNAKVFIWGHSLGTGVSTHLLGKLSKEPIRKPTGLILESPFTSFTDEIAEHPFAKI
FRPLPWFHYTIIDPMLKNGFVFASDRHIIKVDCPIMILHAEDDMVVPYDLGEKLYKTAID
FRRESQGNVSFLGFPSKLGYGHKFICRAPEIHEIITKFVRESSEETMEKKLV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgaaaggaacaaattccacggggggcacaaagtgatcgaactgtacaaagac
ttcaaatacaatattatacgtgatgacaaagttactgtgaactcgaagtgctgcctgggc
tggtccaaaagaataagtttatggacactcaagttggcactggtgatatttttccttata
tttatagtaggtccatttatttataagtattgctatggagtacaaaggagtttagtattt
ctcaattttgtgagttggccaaagaacccggatttcgataatcccagaaagtatggagtg
gatggagcgatcaacttttatttggacaccgatgaaggcgtccggctcggagtgtggcac
attctacccgaaaacttagtcaataatcggacggagtatagcagggagtacttcggggat
gttcttcgagatggccagaatgtgatgatctacaaccacgggaattccgggcatcgggta
gcgccgcaccgggnnnnnnaagacggtttggttaaagacagcgagttcatttacaattgg
gttacgaaccgcaccaacgccaaggtgttcatctggggacattctttgggaacgggtgtg
tccacccatctcctggggaaactctccaaggagcccattcgaaaaccgaccggtttaatc
ctcgagagtccatttactagcttcaccgacgaaatcgccgaacatccattcgccaaaatt
ttccgtccattgccttggttccactacaccatcatcgatcctatgctgaagaacgggttc
gtcttcgcctccgacagacacatcatcaaggtggactgtccgatcatgattctgcacgcg
gaggacgatatggtcgtgccttacgatcttggcgagaaactctataagactgccatcgat
ttccgacgggaaagtcaagggaacgtttccttcttgggtttcccaagtaaactcggatac
ggtcacaaattcatctgtcgcgcgccggaaatacacgaaattattacaaaattcgtgcgg
gaatcctcggaggagacgatggaaaagaagctggtctaa

DBGET integrated database retrieval system