KEGG   Nicrophorus vespilloides: 108562293Help
Entry
108562293         CDS       T04922                                 

Definition
(RefSeq) annexin B9-like
  KO
K17095  annexin A7/11
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108562293
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108562293
  Exosomal proteins of other body fluids (saliva and urine)
   108562293
  Exosomal proteins of colorectal cancer cells
   108562293
  Exosomal proteins of bladder cancer cells
   108562293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 108562293
NCBI-ProteinID: XP_017776073
Position
Unknown
AA seq 320 aa AA seqDB search
MSNQHINPTVRPVDPFDPQEDARCLKKAMKGLGTDEKSLTNILSKRSYEQRMEINVYYKT
MYGKDLQQDLQDETSGHYRDALIALVTPLPCYYAKELNDSLRGICTNEDVLIEILATLTN
NQLKAVRNAYVKNYGKDLESDIIGDTSGTFRRLLVALNNAGRDESSVIDMSAVERDAKAL
YNAGAKRLGTDEDEFIQIFCQRSYEHLRVVFEQYKILSGKEIEQSIKSEFSGDSKECLLA
IARHVLCPSLHFAKRIRGAFKLLTTKHNQLIRFIVTRSSIDMADVKIDYKTKYGHNLEKD
IKKYSGGDYSKLLLALIAEN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcagcacataaacccaacggtgcggccggtggatccgttcgatcctcaagaa
gacgcgagatgtttgaagaaggctatgaaaggtttaggtaccgacgagaagagtttgacc
aatattttatcgaagagaagctacgagcagcggatggaaatcaacgtgtattacaagacg
atgtacggaaaggatctgcagcaggatttgcaggacgagacgagcggtcattacagggat
gcgctcattgcgttggtcacgccgctcccctgctactacgcgaaggaactgaacgactcc
ctgaggggtatctgcacgaacgaggatgtcctaattgaaatactggcgacgctgacaaat
aatcaactgaaagcggtgaggaacgcttacgtgaaaaattacggaaaggacttggagagc
gacataattggtgacacctcgggaacgtttagaaggctattagtagcactgaacaatgct
ggaagggatgaaagtagtgtaattgatatgagcgcagtcgagcgagatgctaaagcccta
tacaacgcaggtgctaaacgtttgggaacagacgaagacgaattcatccagatcttctgc
cagagaagttacgagcatttgagggtcgtcttcgagcagtacaaaatactttcaggcaaa
gaaattgagcagagtataaagagcgaattctcgggagattcgaaggaatgtcttctggca
atcgcgaggcacgtgctgtgtccatctttgcactttgcaaagagaattcgcggcgcattt
aaactgctgacgacaaaacataaccaactgatacggtttattgttaccaggagtagtatc
gatatggcagacgtgaaaatcgattacaaaacgaaatacggacacaatctcgaaaaggac
atcaaaaaatactctggaggtgattacagcaaactattgctcgcccttattgccgaaaat
taa

DBGET integrated database retrieval system