KEGG   Nicrophorus vespilloides: 108562698Help
Entry
108562698         CDS       T04922                                 

Definition
(RefSeq) receptor-type guanylate cyclase gcy-28-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00230  Purine metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108562698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvl01001]
    108562698
Enzymes [BR:nvl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108562698
Protein kinases [BR:nvl01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108562698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 108562698
NCBI-ProteinID: XP_017776592
Position
Unknown
AA seq 796 aa AA seqDB search
MSSMFNSSFDLKGVGPAVDLSLSDINERFLDHHGIKLKKVQASYPSCSDAKTTGEATKLH
YIDNVIAYIGPACICALEPVASLAAYWNIPIITGMGDQPLTERELSVSSSCIMDRLQTWN
NNDMAPHGIIKNNSKFYPTLTRLSYCERHLNLVFTSVLKHFGWKHIALVVDKTDLFSITL
GKNLEYELKREGLQVFVIELKGNDEEMYDKYLKDASIYARVMILSIRASLVRKFMLAAHG
LGMTKGDWVFMDLEMYKGSYWGASTWSVGDKYDTIAKKAYEALIRVSLLQPTSDRFQDFA
NKVKERAQTDYNYIMNSREDVDFAIGAFYDGVYLLGMALNETLSMGGNIRDGLAITKLMW
GRDFHGISGYVRFDHNGDRVADYSIQDLDPKTGKFYAVAHYYDLHKEYLPVPEQKIYWPG
GREDPPPDIPEPGFLDEKIIIIIYGIVALVLIFILRGFLACVRIMCARQVPTDQNIMQWR
VRPDEMMFELGILYEPEFLSLFQSLDVSSSRPSASFINSLQSAPLGMYKGTRVFIKKIVK
KNMDINKKVLCEIKQVINIGHENTVRFLGACIENPGILIITEYCPRGSLRDVLDNNEINL
NWKNKLSLIENIAKGMKYLHNSEVSVHGKLNSHNCLIDGDFVLKICDFGLTTLMIPDDIS
EDINHYHKLLWVAPELLPLTVVPGIPATQKGDVYSFAIILEEIILRAGPFFVTLQLEQLC
IYDILKRVADREIPPFRPVVDQTNCHKNLILLMKSCWEDNPDCRPPFNVICRAVKYIITC
YKENLLDDPQYGPEHY
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgatgttcaattcttctttcgatttgaaaggagttggtccagcagtcgacctg
tctttgagtgacatcaacgagcgattcttggatcatcacggcatcaaactgaagaaagtt
caagcaagttatccgtcgtgcagcgatgcgaagactacaggagaagcgaccaaattacac
tatattgataacgtgattgcatatatcgggcctgcttgcatatgtgcactagaacctgtt
gcgagtcttgctgcatattggaatataccaataatcactggaatgggagatcaaccactt
accgaaagagaactctctgtctcttcctcttgtataatggacaggttgcagacatggaac
aataacgatatggccccacacggaattatcaagaacaatagtaaattctatccgacgttg
accaggctctcatactgcgaacgtcacttgaatttagtatttacttctgttttaaaacat
ttcggttggaaacacatcgctttggttgtggacaaaactgatctattttctataacactc
gggaaaaatctggagtatgagttgaagcgtgaaggtctgcaggtcttcgtcattgaatta
aagggaaacgacgaagagatgtacgataagtatctcaaggatgccagcatatatgcaaga
gttatgatattgagtatacgcgcatctcttgtaaggaagttcatgctggccgcccacggt
ttaggcatgactaaaggagattgggtgttcatggacttggagatgtataaagggagttat
tggggagcctcgacttggtcggttggggacaagtacgacactattgcaaaaaaagcatac
gaggctctcatcagagtgagtttacttcagcccaccagcgatagatttcaggattttgcg
aataaggttaaagaaagagcccagactgattacaattacattatgaacagcagagaagat
gtggatttcgcgattggcgcattttatgacggtgtttacttgcttggtatggctttgaac
gagacgctttctatgggtggaaacatcagagacggtctggccataaccaaattgatgtgg
ggtcgtgactttcacggaattagcggttacgtcaggttcgaccacaacggagatagagtt
gcggattactccatacaggatctggacccaaagactgggaaattttacgcagtcgctcat
tactacgatttgcacaaagagtatttgccggtgcccgagcagaagatctattggcctgga
ggacgggaagaccctcctccggatattcccgaacctggatttttggatgaaaaaataata
attattatatatggaattgtcgctttagtattgatcttcattctcagaggttttcttgcg
tgtgttcgcattatgtgtgcacgacaagtacctacggaccaaaacatcatgcagtggcgc
gtacgacccgatgagatgatgtttgagttagggatactatacgaaccagaatttctaagt
ttatttcaatcgttggatgtatccagcagcagaccttctgcttcattcatcaactcgctg
cagtcggcacctttaggaatgtacaaaggcactcgcgtattcattaagaaaatcgtcaag
aaaaacatggacattaacaagaaagttctctgcgaaataaagcaagtcataaatattgga
cacgagaataccgttcgcttcttaggtgcgtgtatcgagaatccgggaatactgatcatc
accgaatactgtcccagaggtagtttgcgtgatgttcttgataacaatgaaatcaacctg
aactggaaaaacaagttgtcgctgatcgagaatattgcgaaagggatgaaatacctgcac
aacagcgaggtgtccgttcatggaaaactgaattcccacaattgtttaatcgatggtgac
tttgtattgaagatctgcgatttcggtctgaccactctaatgataccagatgatatctct
gaggatataaatcactatcataaacttttatgggttgctcctgaactacttccactaacc
gtcgtaccaggaattccagcaacgcaaaaaggcgacgtctacagttttgctataatcctc
gaggagattattttgagagccggtcctttttttgtcacattgcaacttgaacagctatgt
atttacgatattttaaaacgcgtggctgacagggaaattcctccattcagaccggtcgtg
gatcagaccaactgtcataagaatttgattcttctcatgaaatcatgctgggaggacaac
ccagattgtaggcccccattcaacgtgatctgtcgggcagtcaaatacatcataacatgc
tacaaggaaaacctgttggatgacccacagtatgggccagagcattattaa

DBGET integrated database retrieval system