KEGG   Nicrophorus vespilloides: 108563490Help
Entry
108563490         CDS       T04922                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00010  Glycolysis / Gluconeogenesis
nvl00562  Inositol phosphate metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108563490
   00562 Inositol phosphate metabolism
    108563490
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108563490
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108563490
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108563490
NCBI-ProteinID: XP_017777674
Position
Unknown
AA seq 752 aa AA seqDB search
MEVQTYLILKWLFLLIAAKSIFGDIYDEDRNRGESYDPYNTNRDQYGRDNYNRNQYDSRN
NQTGNYDPYNRNYGRNEQRYNSSDPYNRDPYNANDPYNRNPSDPNNRNQNDPYNRNQNDP
YNKNQNNPYNRNQNDPYNRNQNDPYNKNQNDPYNRNPSDPYNRNQNDPYNRNQNTYNRND
NRNDFNRNPNDPYGANDSQNRNPNDPYNKNPNDPYNRNQNDPYNRDGNRGDFNRNNDNRD
DRFRNNESNYGTGKFGDDDGKCCEEYCYSTDSDAYVRMGSKTSYQFVYGKTSNQHVVPQC
KPVQYWSAFREGTSIPDRMSIERYRNLQRIHDQIMKNYGERGSYPNRGRLCAEDYSLIRS
WGWNETVNEHKSGSLSSQGAEDLKFIARRIQSRFRDLLVPYSETQYYFEYTEGDKSYESY
QAFIQGLFGNDAQRVHATVRNPASFNSYGDNSNQNQIYSPFSQGSYSPSFSENRESSQYG
STPDSRCKTYEQRSDEDRSTASEYQTFKQKPEYRDMVRDVFRRLGFRHTLNDTIIEDMYD
LCRYEKSWFITRPSPWCVAFTHAQHKLLEYGEDLFYYYRSGYGHEHLNKNLGCGLLKDLY
ERFERIVDGSTNQAKGIVHFRNIDEILKLMVALGIGQDQGILTADNYYQMDRRQWRTSQL
APFSGNIAAVLYQCDNQNDKYKVMFFMNENPVEFPECSVGLCSWEVVRDKYQMLAQNCRL
DFCERGAAHSNASAAVVLIFSALFGLLSKHLF
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcagacgtacttgatcctgaaatggctgttcctgttgatcgcggcgaaatca
attttcggcgacatctacgacgaggacaggaacaggggcgaatcctacgatccgtacaac
acgaacagggatcaatacggcagggacaattacaatcggaatcagtacgacagcaggaat
aatcaaacgggaaattatgatccttacaacaggaattacggtcgtaatgaacagaggtac
aattcatcggatccctacaatcgtgatccgtacaatgcgaacgatccgtacaacaggaat
cctagtgatccgaacaacaggaatcagaacgatccgtacaacaggaaccaaaacgatcct
tacaataagaaccagaataatccgtacaaccgtaatcagaacgatccctacaacaggaac
caaaatgatccgtataataaaaaccaaaatgatccgtacaacaggaaccccagcgatcct
tacaacaggaaccaaaacgatccctacaacaggaaccagaatacgtacaaccgcaacgac
aacagaaacgatttcaacaggaacccgaacgatccctatggcgccaatgactcacagaac
aggaaccccaacgatccgtacaacaagaatccgaacgatccttacaacaggaatcagaac
gatccttacaacagggatggaaacaggggagacttcaaccgtaacaatgataaccgcgac
gatagattcagaaacaacgaaagcaactacggaactggaaaattcggagatgacgatggc
aaatgttgcgaagagtattgttattccactgattcagatgcttatgttaggatgggcagc
aagacttcgtaccaattcgtttacggaaaaacctctaatcagcacgtagtcccacaatgt
aaaccggtgcaatattggagcgcgttcagggagggcaccagcatccctgatcgaatgtcc
atcgagaggtacaggaatctgcagaggattcacgatcagatcatgaagaactatggtgaa
cgcggatcctatccgaacaggggaagactctgcgccgaggattactccttgataagaagt
tggggatggaatgagacagtcaacgagcacaagtccggatctttgagtagccaaggtgcc
gaagatttaaagttcatcgccagaaggattcagagccgttttagggatcttctcgtcccg
tacagcgagacacagtattacttcgaatatacagaaggagacaagtcctacgaatcctat
caggcgttcattcaaggacttttcggaaacgacgcccaaagggtgcatgccaccgtgagg
aatcctgctagcttcaatagttacggagataacagcaatcagaatcagatttactcgccg
ttctcgcagggctcttattcaccgtcgttcagtgagaaccgtgaatcatcgcagtatgga
tctactccggattccaggtgcaaaacttatgagcaacgctccgatgaagataggagtaca
gcctctgagtatcaaactttcaagcagaaacctgaatacagggatatggtcagggatgtc
ttcaggaggctaggcttcagacacacgttgaacgataccattatcgaggacatgtacgac
ttgtgcagatacgaaaagtcttggttcattacgagaccttctccatggtgcgtggcgttc
actcacgctcaacacaaattgctcgagtacggcgaagatctcttctactattacagatcg
ggatacggacatgagcatttaaacaaaaacctaggctgtggattacttaaagacttgtac
gagagatttgaacgcattgttgatggctccactaatcaagcgaaaggtatcgtgcacttc
aggaacatcgatgagatactgaagcttatggtggctttgggaatcggtcaagatcaaggc
atcttaacggccgacaactattatcaaatggataggaggcaatggaggacctcccagttg
gcgccgttctctggaaacattgccgcagtcctctaccaatgcgacaaccaaaacgacaag
tataaggtgatgttcttcatgaacgagaatcccgtggaattccctgagtgttcagtcgga
ttgtgctcttgggaggtggtcagagataagtaccaaatgttggcacagaactgtaggttg
gacttctgcgaacgcggagctgcacactccaatgctagcgctgccgtggttctcattttc
tcggcgctcttcggcctcctctctaaacaccttttttaa

DBGET integrated database retrieval system