KEGG   Nicrophorus vespilloides: 108563540Help
Entry
108563540         CDS       T04922                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00520  Amino sugar and nucleotide sugar metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    108563540
Enzymes [BR:nvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     108563540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 108563540
NCBI-ProteinID: XP_017777731
Position
Unknown
AA seq 416 aa AA seqDB search
MTQISPRKIRQLGLFVFLSVTGFLVIYKFSSNEFTNYDEGTDLDAEQHEAAHAKALDDIS
SRLKDLEIEFANLEARVPKKYPQIKSLNYLERKRILITGGAGFVGSHLVDRLMFQGHEVI
VVDNFFTGRKRNVEHWIGHKNFELIHHDIVNPLFIEVDQIYHLASPASPPHYMLNPVKTI
KTNTIGTINILGLARRVHAKVLIASTSEVYGDPDIHPQPETYWGHVNPIGPRACYDEGKR
VSETLSYAYAKEHNIEVRVARIFNTYGPRMHMNDGRVVSNFILQALQNDVITIYGSGKQT
RSFQYVTDLVDGLVALMASNYSLPINLGNPVEHTINEFATIIKDLVGGSGKIIHLAEVED
DPQRRRPDISRAKKYLNWEPQVSLAVGLQRTVDYFRKELKKFNYSSNNKFIPERPA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatatcacctcgaaaaataaggcaattgggtctgttcgtgttccttagtgta
acaggtttcctagtgatatacaagttttctagcaatgagtttaccaattacgacgaaggg
actgacctagatgctgagcagcatgaggcagcccatgcaaaggccctcgatgatatcagc
agcagattgaaggatctggaaatcgagtttgccaatttggaggctcgagtacccaagaag
tatccacaaattaaatcattgaattacttggagaggaaaaggatattgatcactggaggt
gcaggttttgttggttcgcatttggttgatagactgatgttccaaggacacgaagtgatt
gtagtggacaacttcttcaccggtcgtaaacgcaacgtggagcattggatcggtcacaag
aacttcgagctgatccaccatgatattgtgaaccctctcttcatcgaggtcgaccaaatt
taccatcttgccagtcctgcgagtcctccccattacatgcttaacccggtgaagacaatt
aagacaaatactataggaacaattaacatattaggattagcgaggagggtgcatgcgaag
gtactgatagccagcacttctgaggtttacggagatccagatatacatccacaaccggaa
acgtattggggacacgtgaatcctattggaccgagggcgtgttacgatgaaggcaaaagg
gtttcggaaacgcttagctacgcctacgctaaagaacacaacattgaggttcgtgttgcc
aggatattcaacacgtacggacccagaatgcacatgaacgatggacgagttgtttctaat
tttatactccaagctttacagaacgacgttataactatttatggatccggaaaacagact
agatcgtttcaatatgtgactgatttggtggatgggttggttgcactcatggcatccaat
tattcattacccataaatcttggaaatcctgtagaacacacgataaatgaatttgcgaca
attatcaaagacttggttggaggtagcggcaaaataattcatttagcggaggtagaggat
gatcctcaaagaagaaggccggacatatccagggcgaagaagtatttgaactgggaaccg
caggtgtcgctcgccgttggcttgcagcgaaccgtcgattattttcgaaaggaattgaaa
aaattcaattactccagcaataacaaatttataccggaaagaccagcataa

DBGET integrated database retrieval system