KEGG   Nicrophorus vespilloides: 108565700Help
Entry
108565700         CDS       T04922                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00061  Fatty acid biosynthesis
nvl00071  Fatty acid degradation
nvl01100  Metabolic pathways
nvl01212  Fatty acid metabolism
nvl04146  Peroxisome
Module
nvl_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108565700
   00071 Fatty acid degradation
    108565700
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108565700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nvl01004]
    108565700
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108565700
Enzymes [BR:nvl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     108565700
Lipid biosynthesis proteins [BR:nvl01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   108565700
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   108565700
  Exosomal proteins of breast cancer cells
   108565700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 108565700
NCBI-ProteinID: XP_017780766
Position
Unknown
AA seq 738 aa AA seqDB search
MKEGLMLSMKKYIRSSADGAGKRQEKQQQQQQQRRQKRKQHRKTKVDTEKTRYNNLEDME
QYLHYIGGGAGALALTGVAAASAFYLASRPTTERLLWPIDDQALLEGPEQIRVSRFSKDC
KDGKFVKHLYNDATTLYECFRRGAKISNNGRCLGWRESFNKPYQWIHYNETLLRAKNVGS
GMVAMGLPAGTETFVGIYAQNCPEWIIAEQAIYCYSMVLVPLYDTLGPDACAFIIKQVDM
HVVICEDDQKCNLLLDRAPKCLRRLICIKEVRPATKQRAKNRGVEIVKFSDVETLGTKNN
HPEMPPKPSDLCTICYTSGTTGNPKGVMLTHENVVASFSAVMMQFGDHKLKSDDVMISFL
PLAHMLERCCENAMYMEGGAVGFYSGDIRRLSDDMKALKPTISPAVPRLLNRIYDKIQSE
VSRSCIKKMLFNMAMSAKENELKRGILRRNSFWDMLVFRKVQEGMGGRLRLMLVGSAPLA
ENVLNFTRCALGCMIVEGYGQTECCAPITLTVQGDHIPGHVGPPVSCCCVKLVDVPEMEY
WANKSQGEVCVKGTNVFQGYFKDPEKTEETIDDNGWHHTGDVGMWLPNGCLKIIDRKKHI
FKLSQGEYIVPEKIENIYIRSQYVQQVFVHGESLKSCIVAIVVPDVDVIKCWAQENGIPG
TLSVLCNHSEVKQLIMDDMLSWGKECGLKSFEQIKDLYLHPDPFSVQNGLLTPTMKSKRP
QIKSYFTPQLEDMYKKLA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagggtttgatgttgagcatgaagaagtacatccgcagctcggcggacggcgcg
ggaaaacgccaggaaaaacaacagcaacagcagcagcagagacgacagaagaggaagcaa
cacaggaaaacgaaagtggacaccgagaagacgagatacaacaatttggaggatatggag
cagtatctgcactacatcggtggaggcgccggggctttggccctgaccggcgtcgcggca
gcctccgctttctatctggcgagcagaccgacgacggagagacttctgtggccgatagac
gatcaggcccttctcgagggtcctgaacaaatcagagtatcgcgtttttcaaaggactgc
aaagatggaaaattcgtgaagcatctgtacaatgatgcgacgacgctgtacgagtgcttc
agacgaggagccaaaatatcaaataatggtcgttgcttgggatggcgcgaatctttcaac
aaaccctaccaatggatccactataacgagacgctgctgagggcgaagaacgtcggttct
ggaatggtcgcgatgggtctgccggccggcaccgaaacattcgtcggaatctacgctcag
aactgtccggagtggatcatcgccgagcaggcaatctactgctacagcatggtgctggtg
cctctgtacgatacactaggaccagatgcctgcgccttcatcatcaaacaggtcgatatg
cacgtggtgatatgcgaggacgatcaaaagtgcaacctgcttctggatcgcgcccccaag
tgcctgagaaggctgatctgcatcaaggaggtgaggccggccaccaagcagcgcgccaag
aaccgcggcgtcgagatcgtcaagttctcggacgttgagaccctaggaacgaagaacaat
catccggagatgccgccgaaaccctctgatctctgcaccatttgctacacgagcggcacc
accggaaaccccaagggcgtgatgctgacacacgagaatgtcgtcgcctccttctcagcg
gtgatgatgcaattcggcgatcacaagcttaagagcgacgacgtcatgatctcgttcctg
ccacttgctcacatgctcgagagatgctgcgagaacgctatgtacatggagggcggtgcc
gtcggcttttattctggcgatattcgccgcttgtccgacgacatgaaggcgctgaagcca
acgatttctccggccgtacctcgtctgctgaaccgcatctacgacaagattcaatcagag
gtgagcaggagctgcatcaagaagatgctcttcaacatggccatgagtgccaaggagaac
gagctgaagcgtggcatactcaggaggaacagtttctgggatatgctcgtcttcaggaaa
gtgcaggagggaatgggcggacgtctgcgcctcatgcttgtaggatccgcgcccctcgcc
gaaaacgtgctcaacttcaccaggtgcgcactcggctgcatgatcgtagagggttacggt
caaactgaatgttgcgccccgatcacgttgaccgtgcagggagatcacatccccggtcac
gtcggtccaccggtatcctgctgctgtgtgaagcttgtggacgttccggagatggaatat
tgggcgaacaagagccaaggagaggtctgcgttaagggaaccaacgtcttccaaggatac
ttcaaggacccggagaaaaccgaggaaaccatcgacgataacggatggcatcataccggc
gacgtcggcatgtggttaccgaacggctgtctgaagatcatcgaccgcaagaagcacatc
ttcaagctgtcccagggcgagtacatcgttcccgagaagatcgagaacatctacattagg
tctcagtacgtgcagcaggtcttcgtgcacggcgaatcacttaagtcgtgcatcgtggcg
atcgtcgttcccgatgtggacgtgatcaagtgctgggcacaggagaacggaatccccggc
accctcagcgtcctctgcaatcattcggaagtgaaacaactgattatggacgatatgctc
tcttggggcaaagagtgcggccttaaatccttcgaacagattaaagacttgtacctgcat
ccggatccgttcagcgtgcagaacggcctcctcacgccgacgatgaaatcgaagcggcca
cagatcaagtcgtacttcaccccgcagctggaggatatgtacaaaaagttggcatag

DBGET integrated database retrieval system