KEGG   Nicrophorus vespilloides: 108565928Help
Entry
108565928         CDS       T04922                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nvl01002]
    108565928
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108565928
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108565928
Peptidases [BR:nvl01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108565928
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108565928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Lipase_3 Abhydrolase_3 Claudin_3 Peptidase_S9 DUF676
Motif
Other DBs
NCBI-GeneID: 108565928
NCBI-ProteinID: XP_017781092
Position
Unknown
AA seq 371 aa AA seqDB search
MVCDKILPKMKLALLKLHSCPRYYRKHCKLSKFMFYSIALIIAILCCLLIIAFIIVPVAF
KYSVTFQRMLMFTNMGLSDNPLDYESPFQGIRNIYHTIDHPDESVTLGIWHVLPTELENE
LDFDKALATSNYSTIIHFHGSGETRTDSKGTFAVLKDYFHVIAVEYRGFGDSSKVLLSEE
GISKDFVEIYKWIRAKTNNHIYIWGHSLGTALSALTITKLKKERLMPMGLILEAPLTSMA
EEIPVHPYGRLFAWLPWFENTIVSPLERNGFFFNTSNSIVDVDCPVMILHAEDDSVIPYT
LGKKLSELAKNARKPNQGNITYYQFSPFWELDHFRIFRYPFLPFLLEKFIKTCNFYSKER
PPIRRKLKKTH
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgataagatattgccaaaaatgaaattagctttactgaagctgcacagttgc
cctagatactatcgaaaacattgtaaattaagcaaattcatgttctactcaatagctttg
ataattgcaatactctgctgcctgctaattatagcattcatcatagtgccggtggctttc
aaatattcagtcacatttcagaggatgctcatgtttacaaacatgggcttatcagacaat
ccgcttgactatgaatcacccttccaagggattcgcaacatataccacacaattgatcat
ccagacgagagcgtcaccttgggcatttggcatgtgttgcctacagagctggagaacgaa
ctggactttgacaaagccttagccacaagcaattacagcacaatcattcatttccatggc
agcggtgaaacaaggactgactccaaaggtacttttgctgtgctcaaggactactttcat
gttattgctgttgaatacagagggtttggtgattccagtaaagtgttgctctctgaagaa
ggcatctccaaagatttcgtggaaatttacaaatggattcgcgccaaaacgaacaatcac
atttacatttggggccactctctgggcaccgctttgagcgctctgacaatcaccaaattg
aagaaggaacggttgatgcccatgggtctgattttggaagctccactgacgtcgatggct
gaagagattccggtgcatccttatggaaggcttttcgcctggttgccgtggtttgaaaac
acgatagtttcaccgttggagaggaacggattctttttcaacactagcaacagcatcgtg
gatgtcgattgcccagtgatgattttgcacgcagaagatgacagcgttataccgtacact
ttgggaaagaagctttcagaattagcaaagaatgctagaaaaccaaaccaagggaacata
acttattaccagttttctccattttgggagctggaccatttccggatattccggtatcct
ttcctaccgttcctattagagaaattcatcaagacctgtaatttctacagcaaagagagg
cctccaattcgtagaaaattaaagaaaacgcattaa

DBGET integrated database retrieval system