KEGG   Nicrophorus vespilloides: 108566099Help
Entry
108566099         CDS       T04922                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvl01001]
    108566099
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvl04131]
    108566099
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nvl04812]
    108566099
   04147 Exosome [BR:nvl04147]
    108566099
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108566099
Protein kinases [BR:nvl01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108566099
Membrane trafficking [BR:nvl04131]
 Others
  Actin-binding proteins
   Others
    108566099
Cytoskeleton proteins [BR:nvl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108566099
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108566099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 108566099
NCBI-ProteinID: XP_017781310
Position
Unknown
AA seq 1202 aa AA seqDB search
MGNTSGKPHPRPRSKKHPLQYKGTDRPAPPGKPYLASELEQTPDVLTIKWDAPLRNGGAP
ISGYLVEHRRTGSPHWVRATPLMVQIPELTMSGLEPGWRYQFRVFAENIVGLSDPSELSE
PLTVTLQRSAITAPRFTQELKDTTALENEKVEFVAHFIGQPAPKMCWFKDGFEIFSSRRT
RILTENDRSILTIHQSAICDEGEIKCTATNKAGHVSTKCRLTLEAPPSIRLPRQYEDGLL
FEIGELIRLKVSVVGLPPPLVFWTHNGESIQENERYEIDNSDRISTLRISEALRSDRGEY
QIKAVNKLGTDITSFLVTVTDKPSPPGKAKVVMALGKSVTLSWNSPNDDGGCKIGNYIIE
YYRLGWNVWLKAATSRQLTTMLGDLIEGSEYKFRVKAESPFGVSEPSEESDAIFIPDPKR
GLLESTGARSKSQPREIVNQQAPIAAKRKKPRSHSSSRSEEESRESPIPPARIRSPPKTP
DQLSPKPQRKETINPELFDRASIGRDLIYGSPEIRMKKVEPPKVEIDKSGRDLIYGSPEV
KMKKTEPPKIEIEKVVAKEKSKSPEIKSRTPSPIISRSPSPKILKEYALKSDMKSPKLSR
ENSENLGGSTEFMMVLYPDTENDFDFENISVAPPLSLSAPELGTEPPQIDILRPFASSTE
LLHERAMIRFYQEALAEEEALKRKQDERRGSIIPKIQINNKDNQDIVGLERKHSLRRRLS
AGGSIPQQVLWAQRRQSLRNSGDFSDLFETKLNKMPLTVEEKRQLMHTRQRSQSEEMEEE
EFEKVRQRMAQNNEPKRRKRISVVEEEFWDEYESSEDERLRYEPKIREINVEEEDETYHP
PRMMVMEHKKYEEPFEILTKPAKLPDANFVPKPILKKNGVESRKNSLVEALNKEEETSRS
AEAVASVAGVAAASVLIPHTILQNREAEEAKVVIDHYGDIVKSYSTKRKSSIPESNPVRE
ALRKAAAAQADIHKSDEEVEDAKKVNNNNVKINSFDERLRNLERKLETQPRSATPMFKKT
EGTQVEMRGREEDVAERNKEQVAVRGREQSRFTKRDVSKSKSPRKARRSSPSPTPGKRKT
SRPPSRSSSKTNARSSSLLRKPKMCEIMTQTSTSIEPADFHEKPLIREDELRTTARIKIR
TTMDYTTDLAMFAVATWVFFFSNELYAIPILLVAGYRQLKDEAERWIPNWIKKRWNNRRH
KK
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacgtccggcaagccccatccgaggccaagaagcaaaaaacatcctctccaa
tacaaagggactgatcgaccagcgccgcccggtaaaccttacttagcctcggagctcgag
cagactcccgacgttctcacaataaaatgggatgcaccattgaggaacggcggtgctccg
atctccgggtacctggtggagcaccgaaggaccggttcgccgcactgggtcagagccaca
cctctgatggtgcagatcccggagctcacgatgagcggattagagccgggatggaggtac
cagttcagggtcttcgctgagaacatcgtcggtctctccgatcccagcgaactctcagaa
cccttgaccgtaacacttcaaagatctgcaataaccgcgccgaggttcacgcaagaactg
aaggatacaacagccctcgaaaacgaaaaggtcgaattcgttgcccacttcattggtcaa
cctgcgcccaagatgtgctggttcaaggacggtttcgagatcttcagcagtcgtcgcacg
aggattttaaccgaaaacgatagaagtattttgaccatccaccaaagcgcaatatgcgac
gaaggcgaaatcaaatgtacagccacgaacaaagccggacacgtttccaccaaatgcaga
ctcactttggaagctccaccaagtatacggttgcctaggcaatacgaagatggtttgctc
ttcgaaataggcgaattgattaggttgaaggtctcggtggtcggacttcctcctcctctg
gtattttggacgcacaacggcgaatccatccaagaaaacgaacgatacgaaatcgacaat
agcgacagaatatccaccctaagaatctccgaagcgttgaggagtgatcgcggcgaatac
caaatcaaagcggtcaataaactaggcaccgatataacatctttcttagtgactgtaact
gataaaccctcacctcctggaaaagcaaaagtcgtaatggctttaggaaaatcggtgact
ttatcatggaacagtccaaacgacgatggtggttgcaaaatcggaaactacatcatagaa
tattatagattgggatggaacgtttggctgaaagccgctaccagtcgccaattaaccaca
atgctaggtgatttaattgaaggcagcgagtataaattcagggtgaaagcggagagccct
ttcggcgtgagcgaacccagcgaagaatcggatgccatattcataccggatccaaagaga
ggtctactagaatccacaggagcaagaagcaaaagccaacccagagaaatcgtgaatcaa
caagctccaatagcagcgaaacgcaagaaaccacgctctcattcctcgtccagatccgaa
gaggagtcacgcgaatctcctatacctccagcacgaatcagaagtccaccaaaaactccg
gatcaactgtcacctaaaccgcaacgaaaagaaaccatcaatccagagttattcgataga
gcttccataggtagagatctgatctatggtagtcctgaaattaggatgaaaaaagtggaa
cctcccaaagttgaaatagacaaatcaggtagagatttaatttacggtagtccagaggtt
aagatgaaaaaaacggaacctcctaaaattgaaatagaaaaagtcgttgcgaaagaaaaa
agtaaatcacccgaaatcaagagcagaacacctagtccaattataagcagatctccgagt
cccaaaatattaaaagagtatgcgttgaagtccgatatgaaatctcctaaattatcaaga
gaaaatagcgaaaatttaggcggcagcaccgaattcatgatggtgctttatccagatacg
gaaaatgattttgattttgagaatatttctgtggcgccaccactatctctgtctgctcct
gaattgggaacggaaccgccgcaaatcgacatcttaagaccgtttgcgagttcgactgag
ctgcttcacgaaagagctatgatcaggttttaccaagaagctttggcggaagaggaagca
ctgaagcgtaagcaagatgagagacgcggaagtataataccaaagatacaaattaacaat
aaggataatcaggatattgttgggttggaaaggaaacattctttgcgcagaagattatca
gctggaggatctataccgcagcaagtactttgggctcagagaaggcagagtttaaggaat
tcaggagatttctctgatctgttcgagacgaagctgaataaaatgcctttaacagttgaa
gagaaacgccagttgatgcatacgcgtcagcgttctcaatccgaagaaatggaagaagag
gaattcgaaaaggtgcgacagcggatggcccaaaataatgaaccaaaacgcaggaaaaga
atcagcgtagtcgaggaggagttttgggatgagtatgaatcctccgaggacgagcgattg
aggtacgaacctaaaataagagagattaacgtggaggaagaggacgaaacgtaccatcct
ccgaggatgatggtgatggagcacaaaaagtacgaagaaccattcgagattctgaccaaa
ccggcgaaattgccggatgcgaatttcgtgccgaaaccgattttgaaaaagaacggagtt
gaatccaggaagaattcattggtggaggctctgaataaggaagaggaaacatctaggagc
gcagaggccgtggcgagcgtcgccggagtggcagctgcaagtgttttaatacctcataca
attttacagaatcgcgaagccgaagaagccaaagtcgttatagatcattacggagatatc
gttaaaagttacagcacgaagaggaagtcaagtatcccggaaagcaatccggttcgggaa
gctttacgtaaagcggcagccgcgcaagccgatatccataaaagcgatgaagaagtggaa
gatgctaaaaaggtaaataacaataacgtgaagattaacagtttcgacgaaagattgcgg
aatttggagaggaaattggagacgcaaccgaggagcgctacgccaatgttcaagaaaacc
gaagggactcaagtcgagatgagaggtcgagaggaagatgtcgcggagaggaacaaagag
caggttgctgttcgtggaagggagcaatccaggttcacaaaaagagacgtttcaaaatcg
aaatcgcctcgtaaagcgcgaagatcttcgccgtctccgacgcccggtaaaaggaagact
tcaaggccaccgtccagatcaagttcaaagacgaatgcaaggagcagttcgctgctcagg
aagccaaagatgtgcgaaatcatgacgcaaacgtcaacttcgatagagcctgcagatttc
cacgagaaaccactgatacgcgaggacgaattgaggaccacggctaggattaaaattaga
acgacaatggattacacgacggatttggcgatgttcgccgtcgccacgtgggtcttcttt
ttcagcaacgaactctacgcaataccaatccttttggtagccggttaccggcagctgaaa
gacgaggcggagagatggattccgaattggatcaagaaacgatggaacaacaggcggcac
aagaaataa

DBGET integrated database retrieval system