KEGG   Nicrophorus vespilloides: 108566935Help
Entry
108566935         CDS       T04922                                 

Definition
(RefSeq) glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00480  Glutathione metabolism
nvl00980  Metabolism of xenobiotics by cytochrome P450
nvl00982  Drug metabolism - cytochrome P450
nvl00983  Drug metabolism - other enzymes
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108566935
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108566935
   00982 Drug metabolism - cytochrome P450
    108566935
   00983 Drug metabolism - other enzymes
    108566935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nvl02000]
    108566935
Enzymes [BR:nvl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108566935
Transporters [BR:nvl02000]
 Other transporters
  Pores ion channels [TC:1]
   108566935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 108566935
NCBI-ProteinID: XP_017782560
Position
Unknown
AA seq 232 aa AA seqDB search
MSVFKLYYNCVSPPCRTVHMVTKALKLNVKLIDVDILTQRYLEQLQNVNPQHTIPVLNDT
GFILWDSHAISAYLVNRYGPQKLYPEETKLRALVDQRLHFDSGILYPTLRKIIVPIMFFN
RFGLSKMDVIKIKQCYEFMDIFMGKSSIWLCGDEMTIADLSCLSTVSTMDMMYPIKEDEY
PNLKRFLRNGERLPYYNDINLNGLNKLSSVIQQKFIKHKEEKEFSGGSKTKL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgttcaaattatattacaattgcgtgagtccaccatgtagaacggtgcatatg
gtaacgaaggcattaaagcttaatgtgaaattaatcgacgtcgatatattgacacaaaga
tatttggaacaattgcaaaacgtgaatccgcagcacacgattcccgtcctcaacgacacc
ggattcattctttgggatagtcacgccatctcagcgtatctggtgaaccggtatgggcct
cagaaattgtatccggaagagacgaagctgagggctttggtcgatcagcgattgcacttc
gactccggcatcctttatccaacattaaggaagatcattgtaccgataatgtttttcaac
agattcggattatccaaaatggatgttataaaaattaagcaatgctacgagtttatggat
atattcatgggtaaatccagtatatggctgtgcggtgatgaaatgacgatagccgatctc
tcctgcttatccaccgtctccaccatggacatgatgtatccaatcaaagaggacgagtac
ccaaacctgaagcgcttcttgaggaacggcgaaaggctaccgtattacaacgatataaac
ctgaacggtttaaataaactgagcagcgtcatccaacagaaattcatcaagcacaaggaa
gaaaaggaattttctggtggaagtaaaacaaaactataa

DBGET integrated database retrieval system