KEGG   Nicrophorus vespilloides: 108568816Help
Entry
108568816         CDS       T04922                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00010  Glycolysis / Gluconeogenesis
nvl00562  Inositol phosphate metabolism
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108568816
   00562 Inositol phosphate metabolism
    108568816
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108568816
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108568816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108568816
NCBI-ProteinID: XP_017785601
Position
Unknown
AA seq 432 aa AA seqDB search
MRVVLKFALLLSLWCTVRCCDDVLEDHLATKSPYRFVGNRNHSRLSFAGCEPSKAWMLIR
HGTRYPSDDYVSAMQSRLPVMREIILSKENGIFRSDRDSLRKWKLDFGEEDAKKLTAEGA
NEMVEIAERMQSRLPEIFSHIYSNTSYNFKFTSTQRTKASAYYFAKGLFGKPTAKDVHFP
EPLKQDPILRFYKLCNKWRKEVKHNPKAVKEATTFKAGPMVKKELTRIAKKLGVHEKNLS
FDDAHYMYMTCAFETAWSRKKKSPWCAPFDVNSAKVFEYAEDLKYYWVDGYGHDITYKQA
CPAFGDMLGHLGDTTSPYPKATLYFTHSGTLLKMLSHLGLYRDERPLRHDNYDEHRLWRS
SRIDAFATNIAFVSYKCGNEISLLALHQEHVVRLPSCPDSDLCPLSKVRSYYEESLNSCS
FDDMCNNTNSNN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgtattgaaattcgcgttgctgttatcgttgtggtgtacggtgcgatgctgc
gacgacgtgctcgaagatcatctggcgacgaaatcgccgtacagattcgtcggtaatcgg
aatcacagcaggctgagttttgcaggatgtgaaccgtcgaaggcttggatgctgatcaga
catgggacgagatacccaagtgatgattatgtgagtgcgatgcagtcgaggttgccggtg
atgagggagatcatactgtccaaggagaacgggatcttcaggagtgacagggattctctg
cgcaagtggaagttggatttcggtgaggaggatgcaaagaagttgactgcggagggggcc
aacgagatggtggagattgcagagaggatgcagtctaggttgccggagatcttctcgcac
atctacagcaacacgtcgtacaacttcaaattcacgagcacgcagaggacgaaggcgagc
gcctactatttcgcaaagggacttttcggaaagccgacagcgaaggacgtgcactttccg
gaaccgctcaaacaagatcccatattgaggttttacaagttgtgcaacaagtggaggaaa
gaggtgaagcataatccgaaagctgtgaaggaggcgaccacgttcaaggctggtccgatg
gtgaaaaaagagttgacgcgcatcgccaagaaattgggggtgcatgagaaaaacctgagt
ttcgatgacgcccactacatgtacatgacgtgcgccttcgagactgcttggagccgcaag
aagaagtcaccgtggtgcgccccgttcgacgtgaattcggcgaaggtgttcgaatacgcc
gaggatttaaagtactattgggtggacgggtacgggcacgacatcacctacaagcaggca
tgtccggcgttcggagacatgctcggtcatttgggcgacacgacatctccgtacccgaag
gcgaccctctacttcacgcattccggcaccctgctgaagatgctctcgcacttgggtctg
tacagggacgagcgacctttgaggcacgacaactacgacgagcatcgcctgtggaggagc
agccgcatcgatgcgttcgccacgaacatcgccttcgtctcgtacaaatgcggcaacgaa
atctcgctgctcgcgttgcaccaggagcacgtcgtcagattgccgagctgccccgactct
gatctctgcccgctgtccaaggtgaggagctactacgaggagagcttgaacagctgcagc
ttcgacgacatgtgcaacaacacgaacagcaacaattga

DBGET integrated database retrieval system