KEGG   Nicrophorus vespilloides: 108568819Help
Entry
108568819         CDS       T04922                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00071  Fatty acid degradation
nvl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108568819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nvl03029]
    108568819
Enzymes [BR:nvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     108568819
Mitochondrial biogenesis [BR:nvl03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108568819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 108568819
NCBI-ProteinID: XP_017785603
Position
Unknown
AA seq 790 aa AA seqDB search
MAEAHSAVAFSFAITHEGWDVNFDREVLNLVWQSGIRSWKKRFARFMNSVHNGVYPAHLW
TLWITMCITSAIHFSGYKVPYDLVTKVMPLLPGSCVRWQLIGSMLAAMGLWLSVIFTMRY
MLKLLLLYKGWMYESRAKGSKPSTFTKFWLLVVRVFSGWNTPKLYSFQGSLPKLPLPALH
DTMTRYLRSARPLLDEDNYKKMEGLASDFENGIGVKLQRYLVLKSWWSSNYVSDWWEEYV
YLRGRSPLMINSNFYGVDTIMMDTDKGQAARAASAINSCLHYRRLVERQELQPILIQGLV
PLCSWQYERIFNTTRIPGIETDKIQHWSDSNHIVVYHKGRYYKVIIYKGRILKPNEIQEQ
IEYILNDASEPLPGEEKLAALTAGERTTWANARRVYFNTGVNKISLDTIEKAAFVVTLDD
VPYEYDSADPTKLDKYGKTLLHGKGYDRWFDKSFTLCIGSNGRLGFNAEHSWADAAVMSH
IWELVLCDDTIRNRADAAVLCHVWEDVIMDNIDKRYENDMKIKDVTPPTPMRLKWDMKSD
CQSVIETAVVSANNLIADLDLKIYVHDAYGKGFMKKAKVSPDAYLQMALQLAYYRDSGKF
SLTYEASMTRLFREGRTETVRPCTIESSEWVKSMDDPKISTEERIRLMQAACVTHQKGYQ
DAMCGKGIDRHLFCLYVVSKYLEVDSPFLQKVLSEPWRLSTSQTPHGQTGRIDLKKHPKC
ISAGGGFGPVADDGYGVSYIIAGEDVLFFHISNKRSSNQTDCHRFADHIRDALADIKSMF
VEPPKQNGKA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcccattcggctgtcgccttttcctttgccatcacccacgagggatgggac
gtgaacttcgatcgggaagtcctaaatttagtgtggcaatccggcattcgatcatggaag
aagagattcgccagattcatgaacagcgtacacaatggagtgtatccggctcacctgtgg
acgctctggattacgatgtgcattacttccgctatacatttctcaggatacaaagtgcct
tatgatttggtgaccaaagttatgcctctgctacctggatcatgtgttagatggcaactg
attggaagcatgctggctgcgatgggactgtggttatctgtgatatttacgatgcgttac
atgctgaaattgctgttactgtacaaagggtggatgtacgaatcgcgcgcgaagggcagc
aagccttcgacgttcaccaaattttggttgctcgtggtgcgcgtgttcagcggatggaac
acgccaaagctgtacagcttccaaggttctttacccaagttaccgttgcctgcgcttcac
gacaccatgacaagatatcttaggagcgctcgtccgttgctcgatgaggacaattacaag
aagatggaaggtttggcctctgatttcgagaacggtatcggtgtaaaattacaacgttat
cttgttttaaagtcctggtggtcgagtaattatgtgtccgattggtgggaagagtacgtc
tacctgaggggacgctcgcccctcatgatcaactccaatttttacggggtcgacacaatc
atgatggatacggacaaagggcaggcggctcgcgccgcctccgccattaactcgtgcctg
cactaccgtcgcttggtcgaaagacaagagctgcagcctattctaattcaaggtttagta
ccgctctgctcatggcaatacgaaagaatctttaacactacccgcatcccgggcatcgag
accgacaaaatccaacattggtcagattccaatcacatagtcgtctatcacaagggaaga
tactacaaagtcattatttacaaggggagaatcctgaaacccaatgagatccaagaacaa
atcgagtacattttgaatgacgcctcggaacctctaccaggtgaagagaaattggccgca
ctgactgctggagagaggacgacctgggccaacgccaggagggtgtacttcaacacgggc
gtcaacaaaatctccttggataccatcgagaaggccgcattcgtcgtcactttagatgac
gtgccctacgaatacgactcagctgaccccacaaaattagacaaatacggaaagacactc
ctccacggaaaaggctacgatcgctggttcgacaaatcgttcacgctttgcatcggcagc
aatggaagactgggattcaacgcagagcactcttgggctgacgccgcagttatgtcgcac
atttgggagctggtgttgtgcgatgacaccatacgtaaccgggctgatgccgctgtactt
tgccatgtttgggaggatgtaattatggacaatattgataagcgatatgaaaatgatatg
aagatcaaggatgtgacgccgcctactccgatgaggttgaagtgggacatgaaatcggac
tgtcaatcggtgatcgagactgccgttgtttccgcgaacaacctcatagctgacttggat
ctgaagatctacgtgcacgatgcgtacggcaagggattcatgaagaaggctaaggtcagt
ccggacgcgtatctgcagatggctctgcagctcgcttactacagggattccggcaagttc
agtctgacctacgaagccagcatgacgagactgttcagggagggcaggactgagacggtg
aggccctgcaccatcgagtcttccgaatgggtgaagtccatggacgatccgaagatctcc
accgaagagaggataaggcttatgcaggcggcgtgcgtcacccatcagaaaggatatcaa
gacgccatgtgcggtaagggcatagacaggcacttgttctgtttgtacgttgttagcaaa
tatttggaggtggactctccgttcctccagaaggtgctgagtgagccgtggaggttgtcc
acgtcgcagacgccgcacggtcagaccggtcgcatcgacctgaagaaacacccgaaatgc
atctccgccggtggcggattcggacccgtagctgatgacggatacggcgtttcttacatc
atcgcaggcgaagacgtgctgttcttccacatctcgaataagcgaagcagcaatcagacc
gattgccatcggttcgcggatcacatcagagatgctttggccgacatcaagagtatgttt
gtagagccaccgaagcaaaacggcaaagcgtaa

DBGET integrated database retrieval system