KEGG   Nicrophorus vespilloides: 108569294Help
Entry
108569294         CDS       T04922                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00020  Citrate cycle (TCA cycle)
nvl00640  Propanoate metabolism
nvl01100  Metabolic pathways
nvl01200  Carbon metabolism
Module
nvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108569294
   00640 Propanoate metabolism
    108569294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108569294
Enzymes [BR:nvl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108569294
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108569294
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108569294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp HipA_C
Motif
Other DBs
NCBI-GeneID: 108569294
NCBI-ProteinID: XP_017786293
Position
Unknown
AA seq 451 aa AA seqDB search
MATILRGFGLAENLAIKNGTKILGSLGGSQIWQPQVQQKRNLNVHEHISYTLLKEAGIQV
PKFGVAKSKAEAKEIAKSLNTNDLVLKAQVLAGGRGRGHFKKGLRGGVKMVFSPEEAEDL
CGKMIGDFLITKQTGEKGRICNAVMVAERKFPRKEYYFAVMMERSFQGPVIIASSQGGVN
IEEVAAENPDAITYEPIDIITGLSKEQAERVATKVGLGSQKEKTTEMLLKMYQLFLKKDA
LLVEINPYAEESPGNFFALDAKFRFDDNAAFRQKELFALRDWTQEDQKEVAAAKFDLNYI
ALDGNIGCMVNGAGLAMATMDIISLHGGSPANFLDVGGGATAQAVKEAFKIITADPKCHA
ILVNIFGGIMRCDVIAEGIIAAAKELSIKLPIVCRLQGTNVDDAKVLIGNSGLKILPVDN
LDEAARLVVKLSKIVSMAKDAKLGINFEMPL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggctaccattctgagagggttcggtttggccgagaatttggccatcaaaaacggcaca
aaaattttgggctcattgggaggttcccagatttggcaaccacaagtgcagcagaaaaga
aatctcaatgtgcatgaacacattagctacaccctcctcaaggaggctggcatccaagta
ccaaagtttggtgttgctaaatccaaagctgaagcgaaagagattgccaaaagtttgaat
acaaatgatttggtgttgaaagcacaagttttagctggaggcagaggtagaggtcatttt
aagaaagggcttagaggtggagtcaaaatggttttcagtccagaggaggctgaagatctc
tgtggtaagatgattggagatttcttgattaccaagcaaactggagagaaaggcagaatt
tgcaatgctgttatggtagcagaaaggaaatttccaaggaaggaatattactttgcagtc
atgatggaaagatcattccaaggaccagtaattattgcttcttcacaaggtggtgtcaat
attgaagaagtggctgctgaaaatccagatgccatcacttatgaacccattgacattatt
acaggcttgtcaaaggaacaagcagaaagggttgctaccaaagtaggattaggaagtcaa
aaggaaaaaaccacagaaatgctattaaagatgtatcaactgttcttgaagaaggacgcc
cttttggttgaaataaacccttatgctgaagaatctccaggcaactttttcgcattggat
gccaaattccgttttgacgataatgccgcgttccgtcaaaaggaactattcgcgttgcgc
gattggactcaagaagaccaaaaggaagtggctgccgcgaaattcgatttgaattacatt
gctttggatggtaacattggctgcatggtgaacggagctggtctggcaatggctaccatg
gacatcatttctttgcatggtggaagccctgccaacttcttggatgttggcggtggcgct
accgctcaagccgtaaaggaggcattcaaaattatcacagctgatcccaaatgtcatgcc
atccttgtcaatattttcggtggtatcatgagatgcgatgtcattgcggaaggtattatc
gccgctgccaaggaattgtccattaaactacctattgtgtgccgtcttcagggtaccaac
gtcgatgatgctaaagtgcttatcggcaattctggtttgaagattttacccgtagataat
ttggacgaggcagctaggttggtcgtcaagttatctaagattgttagcatggctaaggat
gccaaattgggtattaactttgaaatgcctctataa

DBGET integrated database retrieval system