KEGG   Nicrophorus vespilloides: 108569976Help
Entry
108569976         CDS       T04922                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00790  Folate biosynthesis
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    108569976
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     108569976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase
Motif
Other DBs
NCBI-GeneID: 108569976
NCBI-ProteinID: XP_017787265
Position
Unknown
AA seq 236 aa AA seqDB search
MAQVSGRVVIYGGRGALGSKCVQYFKAQNFWVGSIDMHENQEADVNIVVDKDSEFSKQES
TILNNVSSALAGSKLDAIICVAGGWAGGNASKDLIKHSDLMWRQSVWSSLISASIASQYL
KDGGLLTLTGAKAALDPTPGMIGYGMAKAAVHHLVKSLAAENSGLPTDTTVTAILPITLD
TPMNRKWMPNSDYTTWTPLEFIAEKFLEWTKNENRPANGSLCQLITKESNTNVVPV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtatccggtcgcgttgttatttacggtggacgaggagcacttggttccaaa
tgcgtgcaatacttcaaagcccagaatttctgggtaggttcgatcgatatgcatgagaac
caggaggctgatgtcaacatcgtcgtggacaaggacagcgagttcagcaaacaggagtcc
accatcctcaataatgtctccagtgctctggctggatctaagcttgatgccattatttgt
gtggctggtggatgggctggtggaaatgccagcaaggatctcatcaagcactctgatttg
atgtggagacagagtgtttggagctcattgatctcagcttcaattgccagccaatacttg
aaagatggtggtttgctcactctgactggagctaaagctgcccttgatcccaccccaggt
atgattggttacggaatggctaaagctgcagtccatcacttggtgaaatcattagctgcg
gaaaacagcggtctaccaacggacaccactgtcacagcgatcttgcccatcaccttggac
actccaatgaaccgcaagtggatgcccaacagtgattacacaacctggactcctttggaa
ttcatcgccgaaaaattcttggaatggaccaagaatgagaatcgcccagccaatggaagc
ttgtgccaactgatcaccaaggagtcgaacaccaatgtagtacctgtctag

DBGET integrated database retrieval system