KEGG   Nitrososphaera viennensis: NVIE_024650Help
Entry
NVIE_024650       CDS       T03200                                 

Definition
(GenBank) acetyl-CoA synthetase (ADP-forming)
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
nvn  Nitrososphaera viennensis
Pathway
nvn00720  Carbon fixation pathways in prokaryotes
nvn01100  Metabolic pathways
nvn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nvn00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NVIE_024650
Enzymes [BR:nvn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     NVIE_024650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 Pan3_PK YIEGIA
Motif
Other DBs
NCBI-ProteinID: AIC16729
UniProt: A0A060HJJ1
Position
2070798..2072903
Genome map
AA seq 701 aa AA seqDB search
MSSNSIFFSPKSIAVIGASEKPGVGKTIFTNIAKHFKGKIYPVTPSNPTVGGLTAYKSVL
DIPESVDLAVVAAPSRFTPAVMEEVGKKGIKGAIIVSAGFKEVDDEGARLEREVGEISKK
YGIRVIGPNCLGIMSLSKDNMMNSTFLKITPSYGGIALVSQSGAICAATVEDAGAQNIGF
SKVISMGNKVDMDESDVLELLAEDEDTKVVVMYLEDIRNARRFMDIAKRITTEKRKPVIV
LKSGRTAEGAKAAASHTGALGGSDANYEAAFAQCGVIRVDTMGELFDLATAFSKQPLPEG
GVVIVSNAGGPAIISTDACSKYGLKMADISSIRDDIAKVIPAYGSPRNPVDIVGDADYNR
FEKVLNLVLAHPSVGSVVTMCTPSATLNYDDLARVLVKMSRQFPNKTMLASLMGLAEGVE
NRAIMSEGGVPYYLYAEPAIRTLKAVYDFKSWVDSARAKAGTLSFAKDTAKVKEIFASVK
KQGRNNLLEEEGYEVLRAYGFPTPKSILGATEDECVRAAKEIGYPVVMKIASPDIIHKSD
AGGVKVGVKSDDELRAAFRAIIENAKKYKSDAKIKGVLVQEMVKSAKETILGASQDPTFG
PVIMFGLGGIYVEVLKDVVFRVAPIDEREAARMVESIKTIKLLKGVRGERPSDLKAISDS
LQRLSQLVTDFPEIKEFDINPLLVLEEGKGARVVDARIILK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtaattccatcttcttctcgccaaagtcgatagcagtcattggagcttcagaa
aagccgggcgtaggcaagacgatatttacaaacattgccaagcacttcaagggcaagatc
taccctgtcaccccgtcaaacccgacggtgggcggcctgacggcgtacaagagcgtgctg
gacattcctgaaagcgtggaccttgcagtggtggccgcgccaagcaggttcactcccgcg
gtgatggaagaggtgggcaagaaggggataaagggcgcaataattgtttcagcaggtttc
aaggaagttgacgacgaaggcgcccgactcgaaagggaggtgggcgagatttccaaaaag
tacggcatcagggtgatcggccccaactgccttggcatcatgagcctgtcgaaggacaac
atgatgaattccacgttcttgaagataacgcccagctacggcgggatagcgctcgtctcg
cagagcggggccatctgcgcggcgaccgtggaggacgcaggcgcgcagaacatcggcttt
tccaaggtgataagcatgggcaacaaggtggacatggacgaaagcgacgtgctggagctg
ctcgcggaagacgaggacaccaaggtggtggtgatgtacctcgaggacatacgcaacgca
aggcgctttatggacattgcaaagcgcataacgacagaaaagagaaagccggtgatcgtg
ctaaagtctggcaggaccgcggaaggcgcaaaagcggccgcgtcgcacaccggcgcgctt
ggcggctctgacgcaaactatgaagccgcgtttgcgcagtgcggcgtaattcgagtagac
acgatgggcgagctgttcgaccttgccaccgcgttttccaagcagccgctgccagaagga
ggcgtggtcattgtatccaacgccggcggcccggcaatcatatccaccgacgcctgctca
aagtacggcctgaagatggccgacatctcttctattcgcgacgacattgccaaggtcata
ccggcgtacggctcgccgaggaaccccgtcgacattgtgggcgacgcggactataacagg
tttgaaaaagtgctcaacctcgtccttgcgcaccccagcgtgggctctgtcgtgacgatg
tgcacgccatcggcgaccctgaactacgacgaccttgcgagggtgctggtcaagatgtca
aggcagttcccgaacaagacgatgcttgcgtcgctcatggggcttgcagagggcgtggaa
aacagggcgataatgtctgaaggcggcgtcccgtactacctgtacgccgagccggcgata
aggacgctcaaggccgtctatgatttcaagagctgggtcgacagcgccagggccaaggcc
ggcacgctctcgtttgccaaggacaccgccaaggtcaaggagatatttgcaagcgtaaag
aagcagggccgaaacaacctgcttgaagaggaaggctatgaagtcctccgggcgtacggg
ttcccgacgccaaagagcatcctcggcgcgacagaggacgagtgcgtaagggccgcaaaa
gagattggctatcccgtggtcatgaagatagcctcgcctgacatcatccacaagtcagac
gccggcggagtcaaggtcggggtaaagagcgacgacgagctgcgcgccgcattcagggca
ataatcgaaaatgccaagaagtacaagtctgatgcgaagataaagggcgtcctcgtgcag
gagatggtcaagtctgcaaaagaaaccatacttggcgcaagccaggacccgacgtttggg
ccggtcataatgttcggccttggcggcatctatgttgaagtattgaaggacgtggtgttc
cgcgtcgcgcccatcgacgagcgcgaagccgccaggatggtcgagtctataaagacgata
aaactgctaaagggggtcaggggagaaaggccgtccgacctgaaggccatttccgactcg
ctccagaggctgtcgcagcttgtcaccgactttccggaaataaaggagtttgacatcaac
ccgctcctcgtgcttgaagaaggcaagggcgcaagggtggtcgacgccaggataatactg
aaataa

DBGET integrated database retrieval system