KEGG   Natrinema versiforme: FEJ81_00245Help
Entry
FEJ81_00245       CDS       T05974                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nvr  Natrinema versiforme
Brite
KEGG Orthology (KO) [BR:nvr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FEJ81_00245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QCS40848
UniProt: A0A4V6MBG8
Position
complement(51813..53006)
Genome map
AA seq 397 aa AA seqDB search
MVEIATLGTFLVAALASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGFLVGLLGFAGA
VLQGANVSEAVGTGLIAGDVTLSSLAATLALLIAAGLVAIGIFTGYPIATAFTVTGAVIG
TGLAMGGDPAWPKYTQIATLWVLTPFVGGSIAYAVARALRAEVVAEEYLIIVLAAVVGAI
VANIEFALLGSGSGGASIAQASSGWIPGPAVAGTAAATLVIAALWAGAIAVDLRSGTERG
ERHFLLILGGLVAFSAGGSQVGLAIGPLIPLSGELDLPLIAMLVGGGFGLLLGSWTGAPR
MIKAISQDYSSLGPRRSIAALIPSFIIAQAAVLYGIPVSFNEIIVSAIIGSGYAAAGSGG
GVSARKMGVTVLAWIGSLAGAIVVSYVGYTAVGAILL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaatcgccacgctcggaacctttctcgtggccgcactcgcgagtctcttcatg
gcctgggcgatcggtgccggctcgagcggctccaccccgttcgcaccggccgtcggcgcg
aacgcgatttcggtgatgcgagcgggctttctcgtcggactgctgggtttcgccggcgca
gttctgcagggggcgaacgtctccgaggcggtcgggaccggactgatcgccggcgacgtg
acgctctcgtcgcttgccgccacgctcgccctgctcatcgcggccggactggtcgcgatc
ggtatcttcactggctatccgatagcgacggcgtttacggttaccggcgcagtcatcggg
accggtctcgcgatgggcggtgacccggcgtggccgaagtacacccagatcgccacgctg
tgggtcctgacaccctttgtcgggggctcgatcgcctacgcggtcgcccgagcgctccgc
gccgaggtggtcgccgaggagtacctcatcatcgtcttggccgccgtcgtcggcgcgatc
gtcgccaacatcgagttcgcgctcctcgggtcggggtccggcggggcgtcgatcgcacag
gcctcgagcggctggattcccggaccggcggtcgccggaaccgccgccgcgacgctcgtg
atcgcggcgctgtgggcgggcgcgatcgcggtcgatctcagaagcggaaccgaacgcggc
gagcgccacttcctgctgatcctcggcgggctcgtcgcgttctccgccggcggcagtcag
gtcgggctcgcgatcgggccgctgatcccgctgtcgggcgaactggacctgccgctgatc
gcgatgctcgtcggcggcggcttcggcctgttactggggtcgtggaccggcgcgccgcga
atgatcaaggcgatctcgcaggactactcctcgctggggccgcggcggtcgatcgccgcg
ctcatcccctcctttatcatcgcgcaggccgcggtcctgtacggcattccggtctcgttc
aacgaaattatcgtcagcgcgatcatcgggagcggctacgccgcggccggcagcggcggc
ggcgtcagtgcccgcaagatgggcgttaccgtactcgcgtggatcgggtcgctcgccggt
gcgatcgtcgtctcctacgtcggctacaccgccgtcggcgcgatcctcctctga

DBGET integrated database retrieval system