KEGG   Natrinema versiforme: FEJ81_01660Help
Entry
FEJ81_01660       CDS       T05974                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nvr  Natrinema versiforme
Pathway
nvr00020  Citrate cycle (TCA cycle)
nvr00620  Pyruvate metabolism
nvr01100  Metabolic pathways
nvr01110  Biosynthesis of secondary metabolites
nvr01120  Microbial metabolism in diverse environments
nvr01130  Biosynthesis of antibiotics
nvr01200  Carbon metabolism
Module
nvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FEJ81_01660
   00620 Pyruvate metabolism
    FEJ81_01660
Enzymes [BR:nvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     FEJ81_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_9 Pyr_redox_3 FAD_binding_2 NAD_binding_8 HI0933_like Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: QCS41115
UniProt: A0A4V1FXW4
Position
348415..349797
Genome map
AA seq 460 aa AA seqDB search
MSGKYDLVIVGGGISGASLLYTTAKFTDIDSIALIEKESEIAAINSHHTNNSQTLHFGDI
ETNYTLEKAEEVKEGAELLAGYLENQDPDREMHSKRSKMVLGVGDEEVAELEERYEEEGF
GDLFPKLRPIDREEIAELEPKVVEGRDPNTDMLALQTPDGYVVDYGETTKSFVEQASEEA
TVDVYTGTKVEDITPTLDGYTIETDNGRFDSDAAVVAAGSHSLQIAKELGYGQDKVLLPI
AGSFFLADDLLNGKVYTLQMKKLPFAAVHGDADVHDGSITRFGPTAKLVPTLERGRISTV
KDFLDVFGLNAAAFLSYANILSDRILLPYVLRNLVYDLPNVGRKQFLPHVQKVVPSVELE
DIERAKGYGGVRPQIVDTKNKSLDMGEAKIVGDDIIFNITPSPGASTCLKNAMRDTHTLL
EFLDGDYEFDEEAFRSETIDNFPRGDDSAGKKVAAPDADD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaaatacgacctcgtaatcgtcggcggtggtatcagtggcgcgtccctcctg
tacacgaccgcgaagttcactgatatcgactcgatcgcgctgatcgagaaggaatcggag
atcgcagcgatcaactcccaccacacgaacaactcccagaccctccacttcggggatatc
gagaccaactacacgctcgagaaggccgaagaggtcaaagagggggcggaactcctcgcg
ggctatctggagaatcaggaccccgaccgggagatgcactcgaaacgcagcaagatggtg
ctcggtgtcggcgacgaggaggtcgcggaactcgaggagcgctacgaggaggaaggcttc
ggcgacctcttcccgaaactccgaccgatcgaccgcgaggagatcgccgaactcgagccc
aaggtcgtcgagggccgcgaccccaacacggacatgctcgcgctccagacgccggacggc
tacgtcgtcgactacggcgagacgacgaagtccttcgtcgagcaggcgagcgaggaagcc
accgtcgatgtctacaccgggacgaaagtcgaggacatcacgccgacgctcgacggatac
acgatcgagaccgataacggccgcttcgactccgacgccgccgtcgtcgccgccggctcg
cacagcctccagatcgcgaaggaactcggctacgggcaggacaaagtcctgctccccatc
gccgggagcttcttcctcgcggacgacctcctgaacgggaaggtctacacgctccagatg
aagaagctgcccttcgccgcagtccacggcgacgccgacgtccacgacggcagcatcacc
cgcttcggaccgaccgcgaaactcgtgcccaccctcgagcgcggccgcatctcgacggtc
aaggatttcctcgacgtgttcggactcaacgcggcggcgttcctgagctacgccaacatc
ctctcggaccgaatcctcctgccgtacgtgctccggaacctcgtctacgacctcccgaac
gtcggccggaaacagttcctgccccacgtccagaaggtcgtcccgagcgtcgaactcgag
gacatcgaacgcgcgaaaggttacggcggcgtccgcccccagatcgtcgacacgaagaac
aagtccctcgacatgggcgaggccaaaatcgtcggcgacgacatcatcttcaacatcacg
ccgtcgccgggtgcctcgacctgtctcaagaacgccatgcgcgacacgcacacgctcctc
gagttcctcgacggcgactacgagttcgacgaggaggcgttccggtcggagacgatcgat
aacttcccgcgcggcgacgattccgccggcaagaaagtcgctgcacccgacgccgacgac
taa

DBGET integrated database retrieval system