KEGG   Nitrosococcus watsonii: Nwat_0203Help
Entry
Nwat_0203         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ27174
UniProt: D8K8W4
Position
complement(210154..211350)
Genome map
AA seq 398 aa AA seqDB search
MASNLQSYSLNTIELGWLIINEMESVEEISISQGRAQMLQYLQQHFPQFEWRMPVIKRTE
QPHGTLEAPTDLLQKGEHEREIRRWDYAFVVTRADLKSYYKPFALAIPSRAINVAVLSTA
RLAFHSTDDINNTVMSQQIFALGMHLLGDLNDLPHRDDPKGFMYSPHIIRDLERMTSYSE
KEQAQLAEAFAEVGDIRLEEQSQAGKTRPWLFYLKVLGRSRGDIASAVIQAKPWQFPFRL
SRLTAAAISTLLVLIITAEVWELGMSQPPLLVTGLSLLALTGTSLFILKRQQLLLHRGKR
ALTEQTVITNLAITMVVVLGMTTTYLVLFLLVLLLGKIFYNPLLLQGWAASLEGHIYLRH
YLVLSGFIASLGIMMGSLGASFEGQRYFRHVTYVDEEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaacttacaatcttactctctaaacacaatagaattaggatggctgattatt
aatgagatggagtccgtagaagaaatttctatctctcaaggacgggctcaaatgctccaa
tacctgcaacagcactttcctcaatttgaatggcggatgcccgtcattaaacggaccgaa
cagcctcacggcaccctggaagcccccaccgatttactgcaaaaaggcgagcatgagcgg
gaaatacggcgctgggattatgcttttgtagtcactcgcgctgatttaaaaagctattat
aagcctttcgctttggcaataccctcccgggccataaacgtggcggtgctctccaccgcc
cggcttgcttttcactcgaccgatgatataaataacacagtcatgagccagcaaattttt
gctttgggaatgcacttactgggtgatttaaatgatttaccccatagagatgatccgaag
ggatttatgtattctccccacatcatccgtgacttagagagaatgacaagctattcagaa
aaagagcaagcacaacttgctgaagcttttgcagaggtaggagacattcgtttagaagaa
caatctcaagccggcaaaacacggccatggcttttctatcttaaagtcctcggaaggagt
cgcggcgatattgccagcgctgtcatacaagctaagccttggcagtttccttttcgatta
agccgtttaacagcagcagctatctctactttgcttgtcctgatcatcacggctgaagtt
tgggaactaggcatgagccaaccgccgctgcttgtcactgggctttcattgctggcattg
actggcaccagcctgtttattctaaaacggcaacaattattgctgcatcggggcaaacgc
gcattaaccgaacaaacggtcattaccaaccttgccattaccatggtggtggtcctagga
atgacgaccacttacctggtgttatttctgctagtattactcttagggaagatcttctat
aatcccctcttgcttcaaggatgggccgcctctctggaaggccatatttatctccggcac
tatttagtgctatcggggtttatcgcttccttaggaataatgatgggctcgctaggtgct
tcctttgaaggccagcgttattttcgccatgtcacctatgtagacgaggaaatttaa

DBGET integrated database retrieval system