KEGG   Nitrosococcus watsonii: Nwat_0211Help
Entry
Nwat_0211         CDS       T01266                                 

Definition
(GenBank) UreE urease accessory domain protein
  KO
K03187  urease accessory protein
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Nwat_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UreE_C UreE_N
Motif
Other DBs
NCBI-ProteinID: ADJ27182
UniProt: D8K8X2
Position
217283..217786
Genome map
AA seq 167 aa AA seqDB search
MLCFERRLPRDTPADVEMAFTFEQRERSRLRFQLPDGREAAFLIERGAPLAEGERLGTAE
GLVLAIQAEPEPLMEVRSSDSLALVRAAYHLGNRHVRLEIGAHWLRLPPDYVLRDMLTRL
GVEVFEVTAPYQPESGAYGGGHHHSHSHHEGDEFHSQPRLHHFGERQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtttcgagcggcgtctgcctagagatactcccgcggatgtggagatggctttt
acttttgaacagcgggagcgcagtcggttgcgcttccaattacccgatggccgcgaggcc
gcttttcttatcgaacggggcgcacctttggcagaaggagaacgtttgggaacggcggaa
ggcctggtgctggccatccaggctgagcccgagccattgatggaggtacgttcctccgat
tcgcttgctttagttcgggctgcctatcatctgggcaatcgccatgtgcgtttggagata
ggagcgcactggctgcgtttaccgccggattatgtgttgcgggatatgctaacgcgtctc
ggcgtggaagtctttgaggttaccgctccttatcaacccgaatcgggtgcttatggagga
ggccatcatcatagtcacagccatcatgagggggatgaattccattcccagccccgcttg
caccatttcggagagcgccaatga

DBGET integrated database retrieval system