KEGG   Nitrosococcus watsonii: Nwat_0218Help
Entry
Nwat_0218         CDS       T01266                                 

Definition
(GenBank) MraZ protein
  KO
K03925  MraZ protein
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Nwat_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MraZ
Motif
Other DBs
NCBI-ProteinID: ADJ27188
UniProt: D8K8X8
Position
224981..225430
Genome map
AA seq 149 aa AA seqDB search
MFRGITTLNLDAKGRLSIPAKYRKSLGICCESKVVITVDLLESCLQLYPLPEWEAVERKL
IALPSHNRQARYIKRQLIGHAEERELDSHGRILLPLELRSRVELGKNITLVGQGNKFELW
NAAVWEQQIAKEEALNKEELTRELALLGL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcgggggataaccacactcaacctagatgccaaaggtcggttatccatacctgcc
aaataccgcaaatccttagggatctgttgcgagagtaaagttgttattaccgttgatttg
cttgagtcttgtttgcagttataccccctgcccgagtgggaagctgtagagcggaaattg
atagccttaccctcccacaatcgccaggcccggtatatcaagcgccaacttattggccat
gcagaggagcgtgagctggatagccatggtcgcatcctgttaccgctggagttgagaagt
cgggtagaacttgggaagaatattaccctggtggggcagggcaacaaatttgagctttgg
aatgcggcggtgtgggagcagcaaatagcaaaagaagaagcgttgaacaaagaagaacta
actcgggaattggctctattagggctttga

DBGET integrated database retrieval system