KEGG   Nitrosococcus watsonii: Nwat_0227Help
Entry
Nwat_0227         CDS       T01266                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00550  Peptidoglycan biosynthesis
nwa01100  Metabolic pathways
nwa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nwat_0227
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Nwat_0227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
    Nwat_0227
Enzymes [BR:nwa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Nwat_0227
Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
 Precursor biosynthesis
  Glycosyltransferase
   Nwat_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 UDPGT Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: ADJ27197
UniProt: D8K8Y7
Position
235025..236104
Genome map
AA seq 359 aa AA seqDB search
MAVRVLIMAGGTGGHVFPALAVADRLRAWGAEVVWMGTRHGLEAELVPKAGYPIEWISVS
GLRGKGLTHWLRAPFKLLLALSQALRAQRRWQPAVVLGLGGFVAGPGGLGAWLLRRPLLI
HEQNAIVGTANRLLAPLASRVMEAFPGAFPPARKAEWTGNPVRESIEQLSETGVRLQARQ
GRLRLLVFGGSQGAQVLNATVPQALALLPAKVRPQVWHQCGSRQWEEAVAAYRAVGVEAR
LVPFIDDMAAAYAWADLVVCRAGALTVAELMAVGVGALLVPFPLAIDDHQRANAEYLVAA
GAALLLPEKELSSSRLAQAIEHLVANRSILISMAQAARQLHRAGAARRVAERCLEAADG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcagtacgggtgctgatcatggctggcggtacgggggggcatgtatttcccgccctg
gcggtggctgatcggctccgggcatggggggcagaggtcgtatggatgggaacccgccat
gggctggaagctgagctggtgccaaaggcaggttatcccatcgagtggatttcagttagt
ggtttgcgtggtaagggcctaacccattggttaagggcaccattcaaattgttgcttgct
ttgtctcaagctttgcgtgcccagcgccgctggcagccagcggtcgtgctggggctaggt
ggatttgttgctggcccaggggggttgggggcctggctgctgcggcggcctttgctgatt
catgaacaaaatgcaattgtaggcacggccaaccgattgctggctccgctagctagccgg
gtgatggaagcgtttcccggcgcttttcctccagcgagaaaggctgaatggaccggcaat
ccagtgagggaaagtattgagcagctttccgaaacgggggttcggcttcaggctcgacag
ggccgccttcgcttgttagttttcggcggttcccagggggcgcaagtattaaatgcaacc
gttcctcaggccctggccctattgcccgccaaagtgcgtccccaggtctggcatcagtgc
ggctcccggcaatgggaagaggctgtagctgcttatcgagcggtgggagtggaggctcgg
ctagtgccttttattgatgatatggcagcggcttatgcctgggctgatttagtggtgtgc
cgcgccggcgcgttgacggtggcagagttaatggccgtgggagttggtgctttactggtg
ccgtttccattagcaattgatgaccatcaacgggccaatgcggagtatctcgttgcggcc
ggggccgctctattattgccggaaaaggagctatcctcgtcgcgcctggcgcaagcaatc
gaacatttggtagcaaaccgctctattttgataagcatggctcaggcggcccggcaactt
catcgggcaggcgcggctcggcgggttgctgagcggtgtctggaggcggccgatggttga

DBGET integrated database retrieval system