KEGG   Nitrosococcus watsonii: Nwat_0231Help
Entry
Nwat_0231         CDS       T01266                                 

Definition
(GenBank) cell division protein FtsQ
  KO
K03589  cell division protein FtsQ
Organism
nwa  Nitrosococcus watsonii
Brite
Chromosome and associated proteins [BR:nwa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Nwat_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsQ POTRA_1 STAR_dimer
Motif
Other DBs
NCBI-ProteinID: ADJ27201
UniProt: D8K8Z1
Position
239366..240166
Genome map
AA seq 266 aa AA seqDB search
MARRKKNRRVQRGASRSQPPRAFPWWTIGRGLLALLLVAVVVWGSNRLTDPKTLPLRQVS
IKGQFKRVTQQKLHRVTANYVSGGFFNVNLKAIRMAVEKLPWVAQANVRRVWPDSLQIEV
HEKIPLARWGEDALISIEGEIFTPPEASFPKGLPKLQGPPDSERLLMSRLGKIQAQLSSL
GLQVVQLTLGERRDWHVVFEDGMELILGRAHSKQRLTRFQQIYAHLLRLHREDIKRVDMR
YTNGFAITWHDGNTAPAWVREAAFDV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtagaaaaaaaaaccgccgagtacagcgtggggcgagtcgttcccagcctccc
cgcgcctttccatggtggacgattggtcgaggcttgctggcattgttgcttgtagcggta
gttgtatggggaagtaaccgtctcaccgatcccaaaactttgcccctgcgtcaggtgagc
atcaaggggcagtttaagcgtgtgactcaacaaaaactgcatagggtgacggctaattac
gtaagtggtggcttttttaacgtgaatctgaaggcgatacggatggcagtggagaaatta
ccttgggtagctcaagcaaatgtacgccgagtttggcctgatagcttacagattgaagtt
catgagaaaatacctctggcgcgttggggtgaagatgctttaatcagtattgaaggcgag
attttcaccccacctgaggcgagtttccctaagggattgccaaaattacaaggtcctccg
gatagcgaacgattgttaatgagccgtttagggaaaatacaggcgcaattgagctctctt
gggctgcaggtggttcaacttaccctgggagaacggcgggattggcatgtggttttcgaa
gacggtatggagttgattttggggcgagctcacagcaagcaacgtctaacccgatttcag
caaatctatgcccatttgttgcgattacaccgagaggatataaagcgagtcgatatgcgc
tatacaaatggttttgcaatcacctggcacgacggcaatacggcgcccgcatgggttcgt
gaggcggcattcgatgtctaa

DBGET integrated database retrieval system