KEGG   Nitrosococcus watsonii: Nwat_0238Help
Entry
Nwat_0238         CDS       T01266                                 

Definition
(GenBank) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00220  Arginine biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
nwa01210  2-Oxocarboxylic acid metabolism
nwa01230  Biosynthesis of amino acids
Module
nwa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Nwat_0238
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Nwat_0238
    2.3.1.35  glutamate N-acetyltransferase
     Nwat_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: ADJ27208
UniProt: D8K8Z8
Position
248057..249274
Genome map
AA seq 405 aa AA seqDB search
MAAGLEHLQALLPVAGVELGAMAAGIRYRDRPDLAIITVTEGSTCAAVFTRNVFCAAPVI
VARRHLAGNSPRFLLINAGNANAGTGIQGIVDAETCCATLAELGGVASTAVLPFSTGVIG
ERLPVSHIQAVLPQAWQACSSTGWLAAAHAIMTTDTTPKGTSVHFIYQGHPVTVTGIAKG
SGMIRPDMATMLAFLATDARVSKEVLQRCLARGVAESFNRITVDGDTSTNDACVLLATGQ
SEVSIATVEDPAFAALQQAVSEVCLSLAQAIVRDGEGATKFITIEVTGGRNIQECEQVAY
TIAQSPLVKTACFASDPNWGRILAAIGRSGVPDLEIRGVSLYLGEVCVIHRGVPHPEYTE
EQGRTVMAQDDITLKVELGRGDSRVQIWTCDLSFAYVKINAEYRS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctgctggccttgagcacttgcaagcattgctaccggtagcaggagttgagctgggg
gcgatggctgcgggaattcgctaccgcgatcgtcctgatttagcgataataacagtgact
gagggcagtacctgtgccgctgttttcactcgtaatgtcttttgtgccgcacctgtaatc
gtagctcgtcgtcatttagctggaaactctccgcgctttctcttgattaatgcgggcaat
gccaatgcgggcaccggcatccagggaatagtagatgctgagacctgctgcgccactttg
gccgaactgggtggagtggcttccacggcggttcttcccttttctacgggagtcattggt
gagcggctaccagtctcccatatacaagccgtattacctcaagcctggcaagcgtgctcg
tcgacgggatggttggcagcagcacatgccataatgactaccgataccacacccaaaggt
acctccgtccattttatctatcaaggtcacccagtaaccgtcacgggtattgctaaaggg
tccggtatgatccgacctgatatggctactatgctggcttttctagcgactgatgctcgg
gtttctaaggaagtattacagcgttgtctcgcccgaggagtggcagagagctttaatcgc
attaccgtcgatggtgatacttccacgaatgacgcctgtgtccttctggccacggggcaa
agtgaggtttctatcgccacggttgaggacccggcttttgccgccttgcagcaggcagtg
agcgaggtatgtttatctttggcccaggctattgttcgggatggagaaggggcgactaag
tttattacgatcgaagtgactggagggaggaatattcaagaatgcgagcaggtagcttat
acgattgctcaatctcctttggtcaagaccgcctgctttgctagcgatcccaattggggc
cggattcttgctgctatagggcgcagcggagtgcctgaccttgaaataagaggcgtttct
ctttatttaggtgaggtttgcgtgatccacaggggcgttcctcatcccgagtataccgaa
gagcagggtcgaacagtcatggctcaggatgatatcaccttaaaggtggagttaggcagg
ggggattcccgtgtgcaaatctggacctgcgatctctcttttgcctatgtaaaaattaat
gctgaataccgcagttga

DBGET integrated database retrieval system