KEGG   Nitrosococcus watsonii: Nwat_0240Help
Entry
Nwat_0240         CDS       T01266                                 

Definition
(GenBank) Ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00051  Fructose and mannose metabolism
nwa01100  Metabolic pathways
nwa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Nwat_0240
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     Nwat_0240
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwat_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: ADJ27210
UniProt: D8K900
Position
complement(249670..250554)
Genome map
AA seq 294 aa AA seqDB search
MAKILGIGTATLDIINTVEYYPTEDEERRALSQRRSVGGNCPNTLTVLQQLGHKCAFAGI
VADDPDGQFIAQQLKLEGIKVNNCRVAKGKTPTSYITLSRATGTRTIVHYRTLPEFSFAD
FAKIKLSAFDWLHFEGRNITETLRMLTFVREKLPSLPWSVEIEKPRANIENLFEGATILL
FSRHYAAYHGYAEAQTFLQELHSSLPHTEKVCAWGKEGAYALGDGGEIKHAPAFFPPQVV
DTLGAGDTFNAGFLDARLRNHSLSESLALACQLAGRKCGQQGFKDLGNQQQSIR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatactcggtatcggaaccgccacccttgatattattaacaccgttgaatat
tatcctacagaggatgaagaacgcagggctttatcgcaacgccgctccgtgggggggaat
tgccctaatacccttactgttctccaacagctcggccacaaatgcgctttcgcaggaatc
gtagcggatgaccccgacggacagttcattgcccagcaattgaaactggaaggtatcaag
gtaaataattgccgggttgcgaaaggaaagacacccacatcctatattaccttaagccgc
gctacaggcacccgtacaattgtccactatcggactctcccggagtttagctttgccgat
ttcgcaaagattaagctctctgctttcgattggctccactttgaaggccgtaatattacg
gaaacgcttcgtatgctaaccttcgtccgggaaaaacttccatcccttccctggtcagta
gagattgaaaaacccagagccaatattgaaaatctttttgagggcgccactattttatta
ttctcccgccattatgcagcttaccacggctacgcagaggctcaaacctttctccaggaa
ttacactcatccctgccccatactgagaaagtctgcgcttggggcaaggagggagcctac
gctcttggtgatggaggggagataaaacacgcaccagctttttttccaccccaagtagta
gataccctgggcgcgggagatactttcaacgcggggtttcttgatgcccgtctgcgcaac
cactctctgtctgaaagtcttgctttggcgtgccaactggctggccgtaagtgtggccag
caaggattcaaagacctaggaaaccagcagcaatcaatacgatga

DBGET integrated database retrieval system