KEGG   Nitrosococcus watsonii: Nwat_0241Help
Entry
Nwat_0241         CDS       T01266                                 

Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00230  Purine metabolism
nwa00730  Thiamine metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
Module
nwa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nwat_0241
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Nwat_0241
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Nwat_0241
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwat_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 AAA_33 Hydin_ADK AAA_28 HypA
Motif
Other DBs
NCBI-ProteinID: ADJ27211
UniProt: D8K901
Position
complement(250565..251218)
Genome map
AA seq 217 aa AA seqDB search
MRTVLLGAPGSGKGTQGEHLSQQYNIPQISTGDLLRAAVTAGNELGKQAKAAMEAGELVS
DQIVIGIIRERLTQPDAAKGYILDGFPRNFAQAQALDEVLAVLEQPLQAVILLDVEFEVL
MKRLTGRRTCQACGAIYNIYFSPPQVDQRCDKCSSDQLVQRSDDNEETISNRLRVYEAQT
APLVDYYEAQGKLYRVNGADDITKIAKNIGKILETVK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtgttacttggcgctccaggttctggcaaaggtacccagggtgagcaccta
tcccaacaatataatatccctcagatctctactggagacttgctgcgtgctgctgtaacc
gctggtaacgagctgggaaaacaggcaaaagcagccatggaggcgggggaattagtatct
gatcaaattgtcatcggcattattcgggaacggctaacccagcctgatgccgctaaaggc
tatatcctcgatgggtttccccggaattttgcccaggcccaggcgctcgatgaggtgctg
gccgttctagaacaacctctccaggccgtaattctgctggatgtggaattcgaagtgcta
atgaagcggctcactgggcggcgcacttgccaagcctgcggggctatctacaatatttat
ttttcaccaccccaagtggaccaacgttgtgataaatgcagcagtgatcaactcgttcaa
cgctcggacgataacgaggagaccatcagcaaccgcttacgggtttacgaagcccaaacc
gctcccctggtcgattattacgaagctcaaggtaaactatacagggttaatggcgccgat
gatatcactaaaatcgccaaaaacattggaaaaattctagaaaccgttaaataa

DBGET integrated database retrieval system