KEGG   Nitrosococcus watsonii: Nwat_0244Help
Entry
Nwat_0244         CDS       T01266                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06179  23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     Nwat_0244
Ribosome biogenesis [BR:nwa03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Nwat_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ADJ27214
UniProt: D8K904
Position
complement(253963..254937)
Genome map
AA seq 324 aa AA seqDB search
MNTVKKPPAAQVRILEIHLEQVGQRIDNFLFSHLKGVPKSRIYRCLRRGEVRVNKSRITS
SYRLQQGDQVRIPPLRVSHPPLKRPIAHFLLFLIKNSLLYEDKELLILDKPAGIPVHGGS
GVSYGIIEVLRALRPEATFLELVHRLDRETSGCLMIAKTRGTLLTLQAMQQKQLIHKRYL
ALVKGRWRKNVQRVDLPLLKNISRSKERIVKVSPAGKPAASRFYPKLFYRDEATLVEVAL
ETGRTHQIRVHATHLGHPLGGDEKYGDSTFNKRLRYLGLRRLFLHASQLIFTLPEGKKTI
KTIAPLPEELNAVMEAYAIKIGTK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgtgaaaaaaccgccggcagctcaagtccgcatcctggaaatacacctagag
caggtaggtcagcggatcgacaattttttattctcccatctcaagggggttcccaagagt
cgaatttaccgttgcctccgccgaggagaggtccgggttaataaatctcgcatcactagt
agctaccgcctacaacaaggcgaccaagtcagaattccgccactgcgcgtatctcatccc
ccccttaagagaccgatagcccacttcctcttattcctgattaaaaatagcttattgtat
gaggataaggaactgctcatactcgacaaaccagctggaatcccagttcacgggggaagt
ggtgtaagctatggaattattgaggtgctgcgggctttacgtccagaggcgacttttttg
gagctagtacaccgtttagaccgggaaacttcaggttgtctcatgatagccaaaacccgc
ggcaccttgctgacgctccaagcaatgcagcaaaaacagcttatccacaaacgctatctt
gccctcgttaaagggcgctggcgaaaaaatgtccagcgggtggacttgcccctgctaaaa
aatatatcacgttcaaaagaacgaatagttaaggtaagcccagcaggaaagcctgccgct
agtcgtttctaccccaagctgttttatagggatgaagcgactcttgtagaggttgcctta
gaaaccggccgcactcatcagataagggtacacgccacccaccttgggcatcctctcggc
ggcgatgaaaaatatggtgattccaccttcaataagcggttacgatacttgggactgcgt
cggctatttctccatgctagccaactcatcttcaccctacccgaggggaaaaaaacgata
aagacgattgctcctctaccggaggaattaaatgctgtcatggaagcatacgctatcaaa
atcggaactaaataa

DBGET integrated database retrieval system