KEGG   Nitrosococcus watsonii: Nwat_0245Help
Entry
Nwat_0245         CDS       T01266                                 

Definition
(GenBank) ribonuclease, Rne/Rng family
  KO
K08300  ribonuclease E [EC:3.1.26.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa03018  RNA degradation
Module
nwa_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Nwat_0245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:nwa03019]
    Nwat_0245
   03009 Ribosome biogenesis [BR:nwa03009]
    Nwat_0245
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     Nwat_0245
Messenger RNA biogenesis [BR:nwa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Nwat_0245
Ribosome biogenesis [BR:nwa03009]
 Prokaryotic Type
  rRNA processing factors
   Nwat_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_E_G S1
Motif
Other DBs
NCBI-ProteinID: ADJ27215
UniProt: D8K905
Position
255942..258236
Genome map
AA seq 764 aa AA seqDB search
MKRMLINATHAEELRVAMVDGQYLQDLDIENPAREQKKANIYKGKITRIEPSLDAVFIDY
GADRQGFLPLKEVTRSYFQSHQREPGDRPKVQEVLKEGQELVVQVEKEERGNKGAALSTF
ISLAGRYLVLMPNNPRAGGVSRRIEGEERSMLLEAMRTLEIPEGMGLITRTAAVGKNAEE
LQWDLNYLLHLWRSIQAAAEGQPAPFLIYQESDVIIRALRDYLRLDIGEILIDTPDVYQR
AYDFMRQVMPPELRKLKLYQDKVSLFTRFQIESQIETAFQHEVALPSGGAIVVDYTEALT
TIDINSARANKGEDIEETALSTNLEAAEEIARQLRLRDLGGLIVIDFIDMAPLRNQRAVE
NRLRECLREDRARVQIGRISRFGLLEMSRQRLRPSLGEAHQVVCPRCNGRGQVRGVESLG
LSVLRLIEEGAAKEKTARMVIQLPISVASFLLNEKRANLAAIEKRYGAHLFVVPNSHLET
PTFEIERIKDARKGESRMDKRIEMQSYQMANEPNPKKPALLPPSAIPDEPLVRAGSPLFP
APEPQPVTTEAQPDFLRRFWTTFMDGNQALGVAEGVTQETKVVSEEAGERGRAVPRRGRS
QGRGRRGSGRQPNRKESTQGNESTTGLSSEAESGQVASEAKETQDMQDGTESSAAPSSRT
TARGRRGGRRRRVNATGRYRRGSGRKEEGEAKRPEEAQHLERDSLSSSTALTTSPKSSPE
ETASDRKKAPLEESREGISQEPESSGPTKVGAEGERVAAVKEPL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatgcttattaatgcgactcatgcggaagagttgcgagtagcaatggtcgat
ggccagtacctgcaagatctagatattgaaaatccggctcgggagcaaaaaaaagccaat
atttacaagggtaagattacccgaatcgaaccaagtctagatgctgtatttatagattat
ggcgctgatcgccaagggtttttgccccttaaggaggtgacgcgtagttattttcaatcc
caccagagagaacctggagatcgccctaaagtccaggaagtgcttaaagaaggacaagaa
ttagtcgttcaggtagaaaaagaagagcgaggcaataaaggggcggcgctctctactttt
attagcctagctgggcggtatctcgttttgatgcctaataaccctagggctggcggggtt
tcacgccggatcgaaggagaagagagaagcatgctactggaagcaatgcgtacgcttgaa
attcctgaaggcatgggtcttattacgcggactgccgccgttggcaaaaacgctgaggaa
ttacaatgggatcttaattacttgctccatctttggcgttctatccaggcggccgctgag
gggcagcccgcgccttttcttatctatcaggaaagtgatgttattattcgtgcattacgg
gattacctccgcctggatataggcgagattcttattgatacgccagatgtttaccagcgg
gcctatgatttcatgcgccaagtaatgccccctgagctgcgcaaactcaagctttaccaa
gacaaagtttctcttttcacccgttttcaaatcgagtctcaaattgagacggcgtttcag
catgaggttgcactgccatcgggtggcgcgattgtcgtcgattataccgaggctttgacc
accattgatattaactcagcgcgggcaaataagggcgaggatattgaggagacggccctc
tccactaacctagaggctgctgaggaaatagcacgtcaactaaggctgcgtgatttaggg
ggattgatcgttatcgattttatcgatatggcgccgctgcgcaatcaacgggcggttgaa
aatcggttgcgcgagtgtttgcgcgaggatcgggcgcgggtgcaaataggccgtatttcc
agattcgggctgttagagatgtcgcggcagcgattgcggccctccctaggggaggcccat
caagtagtatgcccgcgttgtaatggtcggggccaagtccggggagtggaatctctgggg
ctatcagtcttacgccttatcgaagaaggggcagctaaagaaaagactgcccgtatggtg
atccagcttcctatttcggtagcttcctttttgctcaatgaaaagcgggctaaccttgcc
gccattgaaaagcgatacggggctcacttgtttgtagttcctaattctcatctggaaacc
ccgacttttgagattgagcgtattaaagacgcaaggaaaggggagagtcgaatggataaa
cggattgagatgcaaagttaccagatggcaaatgagcccaatcccaaaaagccagcactt
ttaccacctagcgctatccccgatgagcccttggttagagcaggttcccctttatttcct
gcgcctgagccccaaccggtaaccacagaagcccagcctgattttttaaggcgtttttgg
acgacattcatggatgggaaccaagcattaggtgtggcagaaggggtgactcaagaaaca
aaagtagtttctgaagaagcgggtgaacgggggcgtgcggttccccgccgcgggcgttct
caaggtagagggcgacgcggttcaggtcggcagcccaatcgtaaggaaagcacacagggc
aatgagagcactactggcctttcttctgaggcagagagcgggcaggtggcatcggaagcg
aaggaaactcaggatatgcaagacggtacggagagttccgccgccccatcttcaaggacg
actgcccgaggccgacggggaggccgacgccgccgcgtcaatgccactggccgatatcgc
cgcggcagcggtagaaaagaagagggagaagcaaagcggccagaagaagcgcagcatctc
gaaagagactccttatcctcttcaacggcgttaacaacttccccaaaatcatctccagaa
gagacggcttctgatagaaaaaaggctccattggaagaaagccgagaaggaatttcccag
gaaccggaatcctctggaccgaccaaggtaggcgctgagggggagcgggtagccgccgtg
aaagagccgctataa

DBGET integrated database retrieval system