KEGG   Nitrosococcus watsonii: Nwat_0247Help
Entry
Nwat_0247         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ27217
UniProt: D8K907
Position
259024..259302
Genome map
AA seq 92 aa AA seqDB search
MIPPPITVTCLRHLIGCRVQYQGIPCRIIEVLEEGPILVLQEAVCHQAIQPDQFGKARRR
APQTLEVNVQDSSGRISPAFLALGVLPLLSSP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgattccccctcccatcaccgttacttgcctacggcaccttattggctgccgagtccag
tatcaaggaattccttgccgaattattgaggtcttagaggaaggccccatactggtgctg
caggaagcagtttgccatcaggcaatccaacctgatcagtttggcaaggcgcgccgccga
gcgccgcaaaccttagaagttaatgttcaagattcatccggccggataagtcccgccttc
ctggccttgggagttttacctttgttatcctctccttaa

DBGET integrated database retrieval system