KEGG   Nitrosococcus watsonii: Nwat_0258Help
Entry
Nwat_0258         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VanZ
Motif
Other DBs
NCBI-ProteinID: ADJ27228
UniProt: D8K918
Position
267221..267610
Genome map
AA seq 129 aa AA seqDB search
MKLKFIWFWRLLGWLLVAVVVYLSLTSSLPDVKLDIQDQDKLGHFTAYALLAWWFSQVYP
ARLHVFWGLFLVVLGITLEFLQDLVGRDFEYGDMLADIMGIVGGYLLARTPAGTALRRLE
CFWEARGAS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaagtttatatggttttggcgtttactaggatggttattggtagctgtcgtg
gtttatttaagccttacctcgtctctaccggatgtaaaactggacatccaggatcaggat
aagttgggacattttacagcttatgcgctgctagcatggtggtttagccaagtttatcct
gcccggctacatgttttttggggtctttttttggtggttttggggattactctggaattt
ttgcaagatctcgtgggccgtgacttcgaatatggagatatgcttgccgatataatggga
atagtgggcggatacctgttagcccgtactcccgccgggacggccttaaggcgcttagaa
tgcttttgggaagcccggggggcgtcgtag

DBGET integrated database retrieval system