KEGG   Nitrosococcus watsonii: Nwat_0281Help
Entry
Nwat_0281         CDS       T01266                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00010  Glycolysis / Gluconeogenesis
nwa00710  Carbon fixation in photosynthetic organisms
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
nwa01230  Biosynthesis of amino acids
Module
nwa_M00002  Glycolysis, core module involving three-carbon compounds
nwa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_0281
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_0281
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nwa04131]
    Nwat_0281
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nwa04147]
    Nwat_0281
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Nwat_0281
Membrane trafficking [BR:nwa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Nwat_0281
Exosome [BR:nwa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nwat_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N NAD_binding_3 GFO_IDH_MocA TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADJ27251
UniProt: D8K9G2
Position
292785..293798
Genome map
AA seq 337 aa AA seqDB search
MAIKVAINGYGRIGRNVLRALYEHNRNSEIQIVAINDLGDANTNAYLTQYDTVHGKFPGE
VSVDGDYLIVNGDKIRVLAERDPAKLPWDQLGVDVVHECTGLFTSKGKASAHLQAGAKKV
IISAPGGGDVDATIVYGVNHDSLKASHAVISNASCTTNCLAPVVKVLQDNIGVEHGLMTT
IHSYTNDQVLTDVYHTDLRRARSATQSMIPTKTGAAAAVGLVLPELNGKLDGFAIRVPTI
NVSLVDLTFVASRNTTKENVDGMMREAAEGDLQGVLAYNDKPLVSMDFNHDPSSSIYEAS
LTKVMGGNLVKVLAWYDNEWGFSNRMLDATVALMNAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtcgcaatcaatggttatggtcgtattggccgcaatgttttgcgggct
ttgtatgagcataaccgcaatagcgagattcagattgttgccattaacgatctaggagat
gccaataccaatgcctatttaacccagtatgataccgtacacggtaaatttccgggagag
gtttccgtcgatggcgattacctgatcgtcaatggcgacaaaattcgtgtgttggccgaa
agagacccggctaaattaccctgggatcagctaggggtggatgtagtacacgaatgtacg
gggttattcactagcaagggaaaagcctcagctcaccttcaagcaggagcgaaaaaagta
attatctcggccccggggggcggggatgttgatgccactattgtctacggcgttaatcat
gattctttaaaagcttcccatgccgtcatttccaacgcttcttgtaccaccaattgcttg
gcgcccgtggtaaaggtgctccaggataacattggagttgagcatggtttgatgaccacg
atccactcctacaccaacgatcaggtacttacggacgtttatcatacggatctccgccgg
gctcggtccgccactcagtcaatgatcccaactaaaacaggtgcagccgcagcggtcggg
ttggtgttgccggaacttaatggcaagctggatggattcgcgattcgagtgccaactatt
aacgtttccctggttgatcttacttttgtggcttcccgtaataccactaaagaaaacgtt
gacggaatgatgcgagaggcggctgagggtgacttgcagggagtgcttgcctacaatgac
aaaccacttgtctctatggacttcaatcatgatccctcgtcgtctatttatgaggctagc
ttgaccaaggtaatgggaggtaatttggtcaaggttttggcatggtatgataatgaatgg
ggcttttccaatcgcatgctggatgccactgtggcccttatgaatgccaagtaa

DBGET integrated database retrieval system