KEGG   Nitrosococcus watsonii: Nwat_0282Help
Entry
Nwat_0282         CDS       T01266                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00010  Glycolysis / Gluconeogenesis
nwa00710  Carbon fixation in photosynthetic organisms
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
nwa01230  Biosynthesis of amino acids
Module
nwa_M00002  Glycolysis, core module involving three-carbon compounds
nwa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_0282
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_0282
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Nwat_0282
Exosome [BR:nwa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nwat_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ADJ27252
UniProt: D8K9G3
Position
293947..295125
Genome map
AA seq 392 aa AA seqDB search
MPILKMSELDLAGKRVLIREDLNVPLKNGEIADDTRIRASLPSIQQAMEAGAKVMVMSHL
GRPTEGEFDTAFSLAPVAEYLSRLLSQEVRLARDWLEGITVEKGQVVLCENVRFNRGEKK
NDEALAKKMAALCDVYVMDAFGSAHRAQASTHGVAKYAPVACAGPLLAGELEALGKALEN
PARPLVAIVGGSKVSTKLTVLESLSQVVDQLIVGGGIANTFIAAAGYNVGKSLYEADLVG
TAKQLRTAAQEGGGDIPLPVDVVCGQEFSESAEAALKRISKVTDDDMIFDIGPETSKHFA
EILKSAGTIVWNGPVGVFEFDQFGEGTKALALAIAESPAFSIAGGGDTLAAVAKYGVGDQ
VSYISTGGGAFLEFLEGKQLPAVAILEERASQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcctattttaaagatgtccgagctggatcttgccgggaagcgtgtccttatccgtgaa
gaccttaatgtacccttgaaaaatggtgaaattgccgatgatacccgtatccgggcatcg
ttgccctcgattcaacaggcgatggaggcaggggctaaggtcatggtgatgtcccacctt
gggcgccccaccgagggggaattcgataccgctttttctctggcgccagtagcggaatat
ttatctcgcctattaagccaagaggttcgtttggcccgggattggctggaggggataacg
gttgagaagggccaggtcgtgttgtgcgagaacgtccggtttaaccggggagagaaaaag
aacgatgaggctctggccaaaaagatggccgctctttgtgatgtttatgtgatggatgcc
tttggcagtgctcaccgggctcaggcctcaacccatggggtggcaaagtatgctccagtt
gcttgcgcgggacctttactggcgggagaattggaggctttgggtaaggctttggagaat
cctgcccggcctctagtggctattgtaggtggttccaaagtttccactaaattaaccgta
ctggaaagcctatcccaagtggtggatcagttgattgtaggcggcggcatcgctaatacc
tttattgcagccgcgggttacaatgtaggtaaatctctttatgaggcagatttagtggga
accgccaagcagcttagaactgcggcgcaggaagggggaggggatatcccactgccggtg
gatgtggtttgtggccaggaattttccgagagcgcagaagctgctcttaagcggattagc
aaggttacggatgatgatatgattttcgatatcgggcctgagacttcgaagcattttgca
gaaatattgaagagtgcggggacgattgtctggaatggaccggtaggtgtatttgaattc
gatcaatttggggaaggcaccaaggctctggcattggcaattgctgaaagccccgccttt
tctatcgccggtggcggcgataccttagccgctgtagcgaaatatggagtaggcgatcag
gtttcttatatttccaccggtggaggggcgtttttggagtttctggaaggaaagcaactg
cctgcggttgccattcttgaagaacgagccagccaataa

DBGET integrated database retrieval system