KEGG   Nitrosococcus watsonii: Nwat_0286Help
Entry
Nwat_0286         CDS       T01266                                 

Definition
(GenBank) malate dehydrogenase, NAD-dependent
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00020  Citrate cycle (TCA cycle)
nwa00270  Cysteine and methionine metabolism
nwa00620  Pyruvate metabolism
nwa00630  Glyoxylate and dicarboxylate metabolism
nwa00680  Methane metabolism
nwa00710  Carbon fixation in photosynthetic organisms
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
Module
nwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nwa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_0286
   00620 Pyruvate metabolism
    Nwat_0286
   00630 Glyoxylate and dicarboxylate metabolism
    Nwat_0286
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_0286
   00680 Methane metabolism
    Nwat_0286
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Nwat_0286
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Nwat_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 F420_oxidored UDPG_MGDP_dh_N TrkA_N 3HCDH_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADJ27256
UniProt: D8K9G7
Position
299309..300244
Genome map
AA seq 311 aa AA seqDB search
MAIKKITIVGAGRVGEATAQFLVKNELCQELVLLDVQEGVAQGAALDIQQSAPLFGFDAW
VTGSTNYELIADSDLVVITAGKPRKPGMSRSDVLDSNLPIITDIMNNVMRFAPQSLVMIV
TNPVDVLTYHAWRHCGWDRARVFGQAGVLDSARMASFIAGETGLSVKDISAMVLGGHGDT
MLPLIRYTTIGGIPLTHFLEQEVIEKIIDRTRHGGFEILRLRQTSSAYDAPAAAIAGMVD
AIRHNRKRILPCVAILEGEYGENEVAMGVPSILGGDGLERIVELPLTEEEQGQFKRSVEA
IRSDLTHLTRT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaagaaaatcaccattgtaggcgcgggtcgggtaggtgaagcaacggctcag
ttccttgtcaaaaatgagctttgccaagaattggtgttacttgatgtacaagagggagtc
gcccaaggggctgctctggatattcaacaatcagcacccttatttggttttgatgcttgg
gtaacgggctcaactaactatgagttaattgcagactcggatttagttgtgatcacggcg
ggtaagccaagaaaaccagggatgtcccgttctgatgttttggattctaatcttcccatt
attaccgacatcatgaataacgtgatgcgttttgccccgcaatctttagtgatgattgta
actaaccctgtggatgtactgacctatcatgcctggcgtcactgcggttgggatcgagcg
cgggtatttggccaagcaggcgtattggactcggcacggatggccagttttattgccggc
gagacgggtttatcagttaaagacatttcggcgatggtactaggcgggcatggggatacc
atgctgccgcttattcgctacacaacgattggtggaatacccttgactcatttccttgag
caagaggtcattgaaaaaattatcgatcgaactcgccatggaggctttgaaattctccgc
ctgcggcagaccagcagcgcctacgatgcaccagcagcagctattgcagggatggtcgat
gcaattcgccataaccgcaagcgtatcctaccctgcgtggcgatcctggaaggcgagtat
ggtgaaaacgaagtggcgatgggagttcccagcatcctgggaggggacggcttagagcgt
attgtggaattacccctgaccgaagaagaacaagggcaatttaagcgctcggtagaggct
attcggtctgatcttactcaccttacaaggacttaa

DBGET integrated database retrieval system